[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF56181.1

[Show Plain Result]


## Summary of Sequence Search
    1::358
    1::165     2e-19  40%  165 aa  PF02774 Semialdhyde_dhC "Semialdehyde dehydrogenase, dimerisation
   25::119     2e-07  36%  120 aa  PF01118 Semialdhyde_dh "Semialdehyde dehydrogenase, NAD binding
    1::358

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxIDKIRYLASARSAGKSLKFKDQDXXXXXXXXXAFEGVDIALF
PF02774         ----------------------------------------------------------------------
PF01118         ----------------------------VEIVALVASSR-AGKKLAFVHEDLTVEDADEEELAGVDIVFL


                         .         .         *         .         .         .         .:140
query           SAGSSTSAXYAPYAVKAGVVVVDNTSYFRQNPDVPLVVPEVNAHALDAxxxxxxxxxxxxxxxxxxLEPV
PF02774         ------------------------------------------------------------------LKPL
PF01118         ALPHGVSKELAPKLAAAGCVVIDLSSAFRLDDDAPYGLPEVNREAIKA----------------------


                         +         .         .         .         .         *         .:210
query           RQKWGLDRIIVSTYQAVSGAGMGAILETQRELREVLNDGVKPRDLHAEILPSGGDKKHYPIAFNALPQID
PF02774         HDAFGIERVIVSTYQAVSGAGRKP----------------KPGVFGSE------------IAFNLIPYID
PF01118         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VFTDNDXXXXXXXXXXXXXXXXXDDSIAVSATCVRIPVLSAHSESVYIETKEVAPIEEVKAAIAAFPGAV
PF02774         GFEHGEPEIKEELKMLAETRKILGFTPKVSATCVRVPVFRGHSETVYVELKEKVDLEEAYELLYAAPEPF
PF01118         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LEDDVAHQIYPQAINAVGSRDTFVGRIRKDLDAEKGIHMWVVSDNLLKxxxxxxxxxxxxxxxxxxxxxx
PF02774         VRDNPEGR-YPTPKAVAGTNFVDVGRIRKDPRGPRGLVVFSVIDNLLK----------------------
PF01118         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxx
PF02774         --------
PF01118         --------