[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF56217.1

[Show Plain Result]


## Summary of Sequence Search
    1::581
    2::271     2e-29  31%  274 aa  PF00664 ABC_membrane "ABC transporter transmembrane region"
    1::123     2e-09  36%  123 aa  PF00005 ABC_tran "ABC transporter"
   33::65      4e-04  48%  160 aa  PF03193 DUF258 "Protein of unknown function, DUF258"
    1::581

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxLVGIVALILVSVLNLIPPMVMGRVIDAITSGXXXXXXXXXXXXXXXXAAFGM
PF00664         ------------------LLLILLALLAGLLALLLPLLLGRLIDSLSDGNGDELSTLYLLALLLLALAVL
PF00005         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           YYLRYVWRMYILGTSYCLGQIMRSRLFKHFTKMSSAFYQTYRTGDLMAHATNDINALTRLAGGGVMSAVD
PF00664         IALLLYLSFYLAAR---LGQRLRRRLFRKLLRLPLSFFDRNPTGELLSRLTNDVEAIDDLLGSTLPLLLQ
PF00005         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ASITALVTLLTMLFSISWQMTLVAILPLPFMAYTTSRLGRKTHKAFGESQAAFSELNNKVQESVSGIKVT
PF00664         ALLT-LVGALILLFLLSWKLALVLLAVLPLLILLAALFGKRLRKLSRKEQEARSELNSVLEESLSGIRTV
PF00005         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           KSFGYQADELKSFQAVNELTFQKNLQTMKYDSLFDPMVLLFVGSSYVLTLLVGSLMVQEGQITVGNLVTF
PF00664         KAFGAEERELERFEEALDEYRKASLKAARLSALLSPLLQLLGALSLALVLWLGGYLVLSGELTVGDLVAF
PF00005         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ISYLDMLVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00664         LSYLLQLL--------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxKGQTLGLVGQTGSGKTSLIKLLLREYDVDKGTIXLNGHDIRDYRLTDLRSLMGYVPQDQFL
PF00664         ----------------------------------------------------------------------
PF00005         ------------------------STLLRLLAGLLKPTSGKILLDGV-ISPLELRKLR--IGYVFQDPAL
PF03193         ---------KGKTTVLVGQSGVGKSTLINALLPDLELKTGEI----------------------------


                         .         .         +         .         .         .         .:490
query           FATSILDNIRFGNPNLPLSAVVEATKLARVYQDIVDMPQGFDTLIGEKGVSLSGGQKQRLAMSRAMILEP
PF00664         ----------------------------------------------------------------------
PF00005         FPLTVRENIAFGLKN---DEKLKEIKKKEAKEEILEALEGLLKFLYRYPHELSGGQRQRVAIARALIKEP
PF03193         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           DILILDDSLSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00664         ----------------------------------------------------------------------
PF00005         KVLLLDEPTS------------------------------------------------------------
PF03193         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxx
PF00664         ---------------------
PF00005         ---------------------
PF03193         ---------------------