[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF56317.1

[Show Plain Result]


## Summary of Sequence Search
    1::514
    3::130     6e-18  35%  183 aa  PF00009 GTP_EFTU "Elongation factor Tu GTP binding domain"
    1::514

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxRTFAIISHPDAGKTTITEQLLYFGGEIREAGTVKGKKTGTFAKSDWMDIEKQRGISVTSS
PF00009         ----------RNIGIIGHVDHGKTTLTDRLLYYTGIIDKRGIVKEA-----AVLDKLKAERERGITIDSA


                         .         .         *         .         .         .         .:140
query           VMQFDYDGKRVNXLDTPGHEDFSEDTYRTLXXXXXXXXXXXXXKGIEAQTXKLFEVVKHRGIPVFTFMNK
PF00009         AWSFETKKYLINIIDTPGHVDFIKEMITGLSQADGAVLVVDAGEGVEPQTREHLLLAFTLGVPLIVVVNK


                         +         .         .         .         .         *         .:210
query           LDRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00009         MDR-------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00009         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00009         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00009         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00009         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxx
PF00009         ------------------------