[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF56337.1

[Show Plain Result]


## Summary of Sequence Search
    1::269
    5::87      1e-05  33%  131 aa  PF01380 SIS "SIS domain"
    6::97      2e-05  33%  102 aa  PF01418 HTH_6 "Helix-turn-helix domain, rpiR family"
    1::269

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxIEANLPNMAYAEKDIAKFFLKQQPLNDYSSKALCEYLNVSKATLTRFAKKCGFKGFRQFI
PF01380         ----------------------------------------------------------------------
PF01418         ----------IRSRYDSLTKSEKKIADYILDNPDKVAFLSIALAEAAGVSEATVVRFCKKLGFSGFSEFK


                         .         .         *         .         .         .         .:140
query           FKYQEMIHEKEKLALYTEATEKVLSDYEEMLxxxxxxxxxxxxxxxxxxxxxAERVYLYGKGSSVLALQE
PF01380         ----------------------------------------------------AKRILFLGRGTSYPVALE
PF01418         LALAEELANKLTSPLNSEISEDLILAEEILL---------------------------------------


                         +         .         .         .         .         *         .:210
query           MKMRFMRLGVIGEVLSDEDMILWSSLLLNENCLVIGASISGQTDIVLEGLQKAADKGAKTVLMTxxxxxx
PF01380         GALKLKELGYIAEVYPAGELKHGPLALIDEGDLVIAISTSGETPETLAALEEAKARGAKVIAIT------
PF01418         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01380         -----------------------------------------------------------
PF01418         -----------------------------------------------------------