[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF56378.1

[Show Plain Result]


## Summary of Sequence Search
    1::210
    2::123     7e-13  36%  123 aa  PF00005 ABC_tran "ABC transporter"
  455::527     9e-05  39%  536 aa  PF02463 SMC_N "RecF/RecN/SMC N terminal domain"
    1::210

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTTLMNMIGKLEPYDGTIFYRGKDLANYKSS
PF00005         ----------------------------------------TLLRLLAGLLKPTSGKILLDGV----ISPL
PF02463         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGGES
PF00005         ELRKLRIGYVFQDPALFPHLTVRENIAFGLKNKEIKKKEAKEEILEALERVGLLKF-LYRYPHELSGGQR
PF02463         ----------------------------------------------------------------LSGGEK


                         +         .         .         .         .         *         .:210
query           QRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLSLRDDNRLIIIATHNPAIWEMADEVFxxxxxx
PF00005         QRVAIARALIKEPKVLLLDEPTS-----------------------------------------------
PF02463         SLTALALLFYKPAPFYVLDEVDAALDDANVQRVADLLKELSKNSQFIVI-THRPGTMELADRLY------