[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF56413.1

[Show Plain Result]


## Summary of Sequence Search
    1::240
    4::144     3e-11  36%  149 aa  PF00849 PseudoU_synth_2 "RNA pseudouridylate synthase"
    1::240

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMMNKPKG
PF00849         ---------------------------------------------------------------VVNKPAG


                         .         .         *         .         .         .         .:140
query           VISATEDPKHRTVLDLLDDLARSKEVFPVGRLDIDTHGLLLLTNNGQLAHVLLSPKRHVDKTYQAQVKGI
PF00849         LVVHPGDPERRTVFDLLPK-GRKPRLGLVHRLDKDTSGLLLLAKDGEAANRLMHPSRKVEKEYLALVHGG


                         +         .         .         .         .         *         .:210
query           MTQEDVETFIKGIPLKDFTCQPARLEILSTDAEKNQSQIRVTIAEGKFHQIKxxxxxxxxxxxxxxxxxx
PF00849         PKKDDPERRRRGVVLEDGKPAVTEYRVLEYGYTGPVTLVELTLHTGRTHQIR------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00849         ------------------------------