[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF56432.1

[Show Plain Result]


## Summary of Sequence Search
    1::652
    1::364     2e-26  32%  366 aa  PF00496 SBP_bac_5 "Bacterial extracellular solute-binding proteins,
    1::652

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00496         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxNIIPSLAEDWTVSQDGLTYTYKLRKDAKWFTSEGEEYAPVTAQDFVTGLQYAADKKSEALYLVQDS
PF00496         ----SLVPDLAESWEVSDDGLTYTFKLRKGVKW--SDG---TPVTADDVVFSFERLLDPKTASPY-----


                         +         .         .         .         .         *         .:210
query           VAGLDDYITGKTSDFSTVGVKALDDQTVQYTLVKPELYWNSKTLATILFPVNADFLKSKGDDFGKADPSS
PF00496         --------ASLLSDDDIEGVEAVDDYTVVITLKKPDPLF----LYLLAPPPASPVPKAKGDDYGTL-PEN


                         .         .         .         +         .         .         .:280
query           ILYNGPFLMKALVSKSAIEYKKNPNYWDAKNVFVDDVKLTYYDGSDQESLERNFTAGAYTTARLFPNSSS
PF00496         PVGTGPYKLKEYDPGQYIVLERNPDYWDGGKPKLDEI--TFRVVPDESTALLALESGEIDDIAGVP-PSD


                         .         *         .         .         .         .         +:350
query           YEGIKEKYKNNIIYSMQNSTSYFFNFNLDRKSYNYTSKTSDIEKKSTQEAVLNKNFRQAINFAFDRTSYG
PF00496         IDQLKANPGLKVLVTGPGLGTYYLGFNTDNPPF------------------ADKRVRQALAYAIDRDAIV


                         .         .         .         .         *         .         .:420
query           AQSEGKEGATKILRNLVVPPNFVSIKGKDFGEVVASKMVNYGKEWQGINFADGQDPYYNPXXXXXXXXXX
PF00496         KAVYGGLGTP---ANGPIPPG-------------------------SPGYDDGLEDYYDPEKAKELLAEA


                         .         .         +         .         .         .         .:490
query           XXXXXXXGVQFPIHLDKTVEVTDKVGIQGVSSIKQSIESVLGSDNVVIDIQQLTSDEFDSSGYFAQTAAQ
PF00496         GYKLGKGGLVLTLLLTS--------GDPERKKIAEAIQQQLKKLGIKVELKAL-----DWAVYLDRL-RK


                         *         .         .         .         .         +         .:560
query           KDYDLYHGGWGPDYQDPSTYLDIFNTNSGGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00496         GDFDIALGGWGADYPDPDNFLDLF-SNSGG----------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00496         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxx
PF00496         ----------------------