[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF56466.1

[Show Plain Result]


## Summary of Sequence Search
    1::121
    3::103     7e-16  48%  107 aa  PF03780 DUF322 "Protein of unknown function (DUF322)"
    1::121

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxGQXELTDEVIATVVGGAATEIFGVVGMASKNALKDNFQALLGKENYSKGVVVKAAEDGSIA
PF03780         ---------GKITISDEVIAKIAGIAAREVPGVVGMAG--GLKDGLAEKLGKENLTKGVKVEVGDDG-VA


                         .         .         *         .         .         .         .:140
query           VDVYTVLSYGTKISEVSKNIQERVAFSLENQLGITAQTVNVYIxxxxxxxx
PF03780         IDLYVVVEYGVNIPEVAENVQEKVKEAVERMTGLEVDEVNVHV--------