[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF56555.1

[Show Plain Result]


## Summary of Sequence Search
    1::408
    3::76      4e-05  43%  402 aa  PF05977 DUF894 "Bacterial protein of unknown function (DUF894)"
    1::408

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxVFLQNRDFRQLTINQWISTLGDTIFYLAFLNYVADASFAPLAILLITISETLPQVLQIFLGVLADFQH
PF05977         --LLLRNRNFRLLWLGQLVSNLGDWIQTVALPWLVYELTGSPLAVGLVGAAQTLPLLLGLLAGVLADFDR


                         .         .         *         .         .         .         .:140
query           HRVLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05977         RRVL------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05977         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05977         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05977         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05977         ----------------------------------------------------------