[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF56657.1

[Show Plain Result]


## Summary of Sequence Search
    1::189
    3::158     6e-32  50%  160 aa  PF04079 DUF387 "Putative transcriptional regulators (Ypuh-like)"
    1::189

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxIEALLFVAGEDGIRVRQLAELLSLPPTGIQQSLGKLAQKYEKDPDSSLALIETSGAYRLVTKPQ
PF04079         ------IEALLFVAGEP-LSLEELAEVLGLEVDEVREALEELQAEYA-DRGRGLELVEVAGGWRLQTRPE


                         .         .         *         .         .         .         .:140
query           FAEILKEYSKAPINQSLSRAALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIKEDGKKEVLG
PF04079         FADYVERLVPEGKPPRLSQAALETLAIIAYRQPVTRAEIEEIRGVNSDGVIRTLLERGLIEEVGRKEVPG


                         +         .         .         .         .         *         .:210
query           RPNLYVTTDYFLDYMGINHLEELPxxxxxxxxxxxxxxxxxxxxxxxxx
PF04079         RPILYGTTEEFLDYFGLKSLDELP-------------------------