[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF56666.1

[Show Plain Result]


## Summary of Sequence Search
    1::480
    3::288     e-103  62%  288 aa  PF02934 GatB_N "GatB/GatE catalytic domain"
    2::139     9e-30  48%  148 aa  PF02637 GatB_Yqey "GatB domain"
    1::480

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxVIGLEVHVELNTNSKIFSPTSAHFGNDQNANTNVIDWSFPGVLPVLNKGVVDAGIKAALALNMDI
PF02934         -----VIGLEIHVQLNTKTKLFCGCPTEFGAEPNTRVCPVCLGLPGALPVLNKEAVEYAIKAALALNCEI
PF02637         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           HKKMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEVELEDGTTKKIGIERAHLEEDAGKNTHGTDGYSY
PF02934         ADESHFDRKNYFYPDLPKGYQITQYDEPIAKNGYIELEVEDGEGKRIGIERIHLEEDAGKSIHGGADYSL
PF02637         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VDLNRQGVPLIEIVSEADMRSPEEAYAYLTALKEVIQYAGISDVKMEEGSMRVDANISLRPYGQEKFGTK
PF02934         VDLNRAGIPLIEIVTEPDIRSPEEAAAYAKKLRQILRYLGISDGGMEEGSLRCDVNVSVRPKGQTELGTR
PF02637         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           TELKNLNSFSNVRKGLEYEVQRQAEILRSGGQIRQETRRYDEANKATILMRVKEGAADYRYFPEPDXPLF
PF02934         TEIKNLNSFRAIEKAIEYEIQRQIELLESGGEIPQETRLWDEDTGTTRSMRSKEGAADYRYFPEPDLPPV
PF02637         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           EIXDEWIEEMxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFFEKAVALDGDAKQVSNWLQGEV
PF02934         EISDEWIEEL------------------------------------------------------------
PF02637         -----------------------------------------------YFEAVVAAGADAKLAANWLMGEL


                         .         .         .         .         *         .         .:420
query           AQFLNAEGKTLEQIELTPENLVEMIAIIEDGTISSKIAKKVFVHLAKNGGGAREYVEKAGMVQISDPAIL
PF02934         ----------------------------------------------------------------------
PF02637         LGYLNKEGLEIDESPVTPEQLAELIKLIEDGTISGKIAKEVLEELLEGGGDPEEIVEEKGLKQISDEGAL


                         .         .         +         .         .         .         .:490
query           IPIIHQVFADNEAAVVDFKSGKRNADKAFTGFLMKATKGQANPQVxxxxxxxxxxxxxxx
PF02934         ------------------------------------------------------------
PF02637         EAIVDEVIAANPKSVEDYKAGKKKALGFLVGQVMKATKGKANPKL---------------