[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF56676.1

[Show Plain Result]


## Summary of Sequence Search
    1::364
    1::383     3e-76  47%  384 aa  PF01053 Cys_Met_Meta_PP "Cys/Met metabolism PLP-dependent enzyme"
    1::364

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxNTILAQAGIKSDEATGALVTPLHFSTTYQHPEFGRSTGFDYTRTKNPTRSKAEEVLATIESAD
PF01053         -------STLAVHAGYEPD-TTGAVAPPIYQTSTFVFDDAGEEPGYIYSRLGNPTRDALEERLAALEGGE


                         .         .         *         .         .         .         .:140
query           YALATSSGMSAIVLAFSGFPVGSKVLAVRDLYGGSFRWFNQVEQEGRFHFTYANTEEELIAELEKDVDVL
PF01053         AALAFASGMAAITAALLALKAGDHIVASDDLYGGTYRLFEKVLPRFGIEVTFVDPTEALEAAIRPNTKLV


                         +         .         .         .         .         *         .:210
query           YIETPTNPLMLEFDIEXXXXXXXXXXXXXXXDNTFYSPIYQRPIEDGADIVLHSATKYLAGHNDVLAGVV
PF01053         FLETPSNPLLEVVDIEAIAAIAHAHGALLVVDNTFATPYLQRPLELGADIVVHSATKYLGGHSDVLGGVV


                         .         .         .         +         .         .         .:280
query           VTNSLELYEKLFYNLNTTGAVLSPFDSYQLLRGLKTLSLRMERSTANAQEVVAFLKDSPAVKEVLYTGRG
PF01053         VDNKFELAERLRFLRRDLGAVLSPFDAWLLLRGLETLALRMERHSENALAVAEFLEAHPKVAKVYYKGGG


                         .         *         .         .         .         .         +:350
query           GMISFKVADETRIPHILNSLKVFSFAESLGGVESLITYPTTQTHADIPAEVRHSYGLTDDLLRLSIGIED
PF01053         GVLSFELGGEEAAKRFLDALKLFSLAVSLGGVESLIEHPASTTHAQLPPEERAAAGITDGLIRLSVGLED


                         .         .         .         .         *         .         .:420
query           ARDLIADLRQALxx
PF01053         VDDLIADLEQAL--