[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF56680.1

[Show Plain Result]


## Summary of Sequence Search
    1::186
    6::183     3e-49  51%  184 aa  PF04011 LemA "LemA family"
    1::186

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxIILGVLALVVIFVIVSYNGLVKNRMQTKEAWSQIDVQLKRRNDLLPNLIETVKGYAKYEGSTLEKVA
PF04011         ---ILLIIIVLLLLWLIGGYNSLVRLRERVKEAWSQIDVQLQRRADLIPNLVETVKGYAKHEKETLERVT


                         .         .         *         .         .         .         .:140
query           ELRNQVAAATSPAEAMKASDALTRQVSGIFAVAESYPDLKASANFVKLQEELTNTENKISYSRQLYNSVV
PF04011         EARAQATLLEDPAELQQAQAQLSGALGRLLAVAENYPDLKANQNFLQLQEELEGTENRIAVARRAYNDAV


                         +         .         .         .         .         *         .:210
query           SNYNVKLETFPSNIIAGMFGFKAADFLQTPEEEKSVPKxxxxxxxx
PF04011         QEYNTAIRTFPSNIVAGIFGFKPKEYFEADEAAREAPE--------