[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF56707.1

[Show Plain Result]


## Summary of Sequence Search
    1::289
  108::261     2e-09  28%  300 aa  PF02896 PEP-utilizers_C "PEP-utilising enzyme, TIM barrel domain"
    1::289

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02896         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxEGHPLFGYRGTRRLLACLDEFQAEAHVVTEVYQTNPNLSVIFPFVNDADQLK
PF02896         ------------------EENPMLGWRGIRLYLDYPEIFEMQLRAILRAAAEGVNLEIMIPMVRTVEELR


                         +         .         .         .         .         *         .:210
query           QAITALRQYGFTGKVGTMIELPSAYFDLSSILETGISKIVVGMNDLTSFVFATMRNSQWHDLESPIMLDM
PF02896         KAKELIEEVGDNGKVGTMIEVPSAAL-LADEFAKEVDFFSIGTNDLTQYTLGVDRDNALYDPFNPAVLRL


                         .         .         .         +         .         .         .:280
query           LRDMQDKARKNKINFAVAGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02896         IGQLIKAAHKAGKKVGICG---------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxx
PF02896         ---------