[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF56712.1

[Show Plain Result]


## Summary of Sequence Search
    1::280
    2::273     1e-42  45%  281 aa  PF00248 Aldo_ket_red "Aldo/keto reductase family"
    1::280

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxLGFGTFKAKDGEEAYRAVLEALKAGYRHIDTAAIYQNEESVGQAIKDSGVPREELF
PF00248         --------------LGLGTMRQVDEEEAIELLDAALEAGINFIDTAEIYGDEELLGEALKEGGVPREDVF


                         .         .         *         .         .         .         .:140
query           VTTKLWNSQQTYEQARQAFEESLEKLGLDYLDLYLIHWPNPKPLRENDQWKIRNAEVWRAMEDLYQEGKI
PF00248         IATKVWPPDLSPEHIRASVEASLKRLGTDYIDLYLLHWPDPDTPRIE--------ETLEALEELVKEGKI


                         +         .         .         .         .         *         .:210
query           RAIGVSNFLPHHLDALLETAKILPAVNQVRLAPGVYQDQVVAYCREKGILLEAWGPFGQGELFDSKQVQE
PF00248         RYIGVSNFTAEQLEELLAHAKIPPVVVQVNLLRRLEERELLPYCRENGIGVVAYSPLGGGNLAAVEELKE


                         .         .         .         +         .         .         .:280
query           IAANHGKSIAQIALAWSLAEGFLPLPKSVTTSRIQANLDCFGIELSHEExxxxxxxxxxxxxxxxxxxxx
PF00248         IAEKHGVTPAQVALAWVLSRPGVTIPGASTPEQLEENLAALDFELTDEE---------------------