[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for spne4:ACF56852.1

[Show Plain Result]


## Summary of Sequence Search
    1::156
    2::60      2e-10  51%   69 aa  PF01316 Arg_repressor "Arginine repressor, DNA binding domain"
   16::69      5e-10  41%   70 aa  PF02863 Arg_repressor_C "Arginine repressor, C-terminal domain"
    1::156

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxKSEHRHQLIRALITKNKIHTQAELQALLAKNDIQVTQATLSRDIKNMNLSKVREEDSAYxxxxxxxxx
PF01316         --KKEQRQQLIKELIKEEKIETQEELVELLQEEGFEVTQATVSRDLKELGLVKVRNAKGEY---------
PF02863         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxVLLKTLPGLAQSFGSIIDTLSFPDAIATLCGNDVCLIICEDADTAQK
PF01316         ----------------------------------------------------------------------
PF02863         -----------------------IVLKTLPGNAQLIARLIDSLKLPEILGTIAGDDTILVICRSEEDAEK


                         +         .         .         .         .         *         .:210
query           CFEELKKxxxxxxxxx
PF01316         ----------------
PF02863         VLERILK---------