[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF54777.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1yzfA1.bssp"
#ERROR : Can't open dsspfile "1ivnA.bssp"
#ERROR : Can't open dsspfile "1vjgA.bssp"
#ERROR : Can't open dsspfile "3dc7A1.bssp"

## Summary of PDB Search
:605
    7e-09  16%  1yzfA1 [c.23.10.5] LIPASE/ACYLHYDROLASE A:1 -- 195
    2e-08  18%  1ivnA  [c.23.10.5] THIOESTERASE I
    3e-06  13%  1vjgA  [c.23.10.6] PUTATIVE LIPASE FROM THE G-D-S-L FAMILY
    1e-04  13%  3dc7A1 [c.23.10.9] PUTATIVE UNCHARACTERIZED PROTEIN LP_3323 A:18 --
:605

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1yzfA1          ----------------------------------------------------------------------
1ivnA           ----------------------------------------------------------------------
1vjgA           ----------------------------------------------------------------------
3dc7A1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1yzfA1          ----------------------------------------------------------------------
1ivnA           ----------------------------------------------------------------------
1vjgA           ----------------------------------------------------------------------
3dc7A1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1yzfA1          ----------------------------------------------------------------------
1ivnA           ----------------------------------------------------------------------
1vjgA           ----------------------------------------------------------------------
3dc7A1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1yzfA1          ----------------------------------------------------------------------
1ivnA           ----------------------------------------------------------------------
1vjgA           ----------------------------------------------------------------------
3dc7A1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1yzfA1          ----------------------------------------------------------------------
1ivnA           ----------------------------------------------------------------------
1vjgA           ----------------------------------------------------------------------
3dc7A1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1yzfA1          ----------------------------------------------------------------------
1ivnA           ----------------------------------------------------------------------
1vjgA           ----------------------------------------------------------------------
3dc7A1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xDANSLGIADGTMLIGDSVALRANTALQTALPGAQINAQVSVTTKTANEIMLNNSQNKFLPKTVVIATGV
1yzfA1          -DSITAGYLDEAVSPVLVDLVKRDIAAMGLEEVAVINAGMPGDTTEDGLKRLNKEVLIEKPDEVVIFFGA
1ivnA           ------------LILGDSLSAGYRMSASAAWPASVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGG
1vjgA           ------------CFVGDSFVNGTGDPECLGWTNLGIRRDTSSDIAKRWLQEVSLRLHKEYNSLVVFSFGL
3dc7A1          ------------AWLGDSITANNGLALAADWDVERSNLGISGST-IGSRYDAXAVRYQAIADFIAVFGGV


                         *         .         .         .         .         +         .:560
query           NNPENYKDDWDSIVKNLPKGHHMILVTPYEGDKTKETYAIVEKAAAYMRELAEKTPYITIADWNQVAKEH
1yzfA1          NDVATFRENLETMIHEIGSEKVILITPPYADSGRRPERTRIKELVKVAQEVGAAHNLPVIDLYKAMTVYP
1ivnA           NDGLRGFQPQRQILQDVAANAEPLLMQI--RLPANYGRRYNEAFSAIYPKLAKE-FDVPLLPFFMEEVYL
1vjgA           NDIAETIKNTREILTQAKKLYPVLXISPAPEQQDPGRRRRTIDLSQQLALVCQDVPYLDVFPLLEKPSVW
3dc7A1          NLGQYGDCDXTTFYGALXPTVPKLFISAIFSAVTNGLGYRQSDYEAAIAQXTADYGVPHLSLYRDAGXTF


                         .         .         .         *         .         .         .:630
query           PEIWAGTDQVHFGSESSTIEAGAKLYADTIATALQTAxxxxxxxx
1yzfA1          TDEFLQADGLHFS------QVGYELLGALIVREIKGR--------
1ivnA           KPQWMQDDGIHPN------RDAQPFIADWMAKQLQPL--------
1vjgA           LHEAKANDGVHPQ------AGGYTEFARIVENWDAWL--------
3dc7A1          AIPAQSVDTLHPN------NAGHRVIARKLQSFLDSH--------