[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF54875.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1bhwA.bssp"
#ERROR : Can't open dsspfile "1zy9A2.bssp"
#ERROR : Can't open dsspfile "1a0cA.bssp"
#ERROR : Can't open dsspfile "1hp4A1.bssp"
#ERROR : Can't open dsspfile "1we5A4.bssp"
#ERROR : Can't open dsspfile "1ktbA2.bssp"
#ERROR : Can't open dsspfile "2ot9A1.bssp"
#ERROR : Can't open dsspfile "1m7xA3.bssp"
#ERROR : Can't open dsspfile "1al0G.bssp"
#ERROR : Can't open dsspfile "1wp0A1.bssp"
#ERROR : Can't open dsspfile "2aaaA2.bssp"
#ERROR : Can't open dsspfile "1dhrA.bssp"
#ERROR : Can't open dsspfile "1nouA1.bssp"

## Summary of PDB Search
:738
    4e-25  14%  1bhwA  [c.1.15.3] XYLOSE ISOMERASE
    3e-18  20%  1zy9A2 [c.1.8.13] ALPHA-GALACTOSIDASE A:178 -- 525
    8e-13  12%  1a0cA  [c.1.15.3] XYLOSE ISOMERASE
    4e-12   8%  1hp4A1 [c.1.8.6] BETA-N-ACETYLHEXOSAMINIDASE A:151 -- 506
    3e-10  23%  1we5A4 [c.1.8.13] PUTATIVE FAMILY 31 GLUCOSIDASE YICI A:248 -- 585
    5e-08  15%  1ktbA2 [c.1.8.1] ALPHA-N-ACETYLGALACTOSAMINIDASE A:1 -- 293
    1e-07   9%  2ot9A1 [c.52.1.33] HYPOTHETICAL PROTEIN A:2 -- 180
    2e-05  15%  1m7xA3 [c.1.8.1] 1,4-ALPHA-GLUCAN BRANCHING ENZYME A:227 -- 622
    2e-04   6%  1al0G  [b.121.5.1] SPIKE PROTEIN GPG
    2e-04   9%  1wp0A1 [c.47.1.10] SCO1 PROTEIN HOMOLOG A:138 -- 297
    3e-04  14%  2aaaA2 [c.1.8.1] ALPHA-AMYLASE A:1 -- 381
    3e-04   6%  1dhrA  [c.2.1.2] DIHYDROPTERIDINE REDUCTASE
    3e-04   9%  1nouA1 [c.1.8.6] BETA-HEXOSAMINIDASE BETA CHAIN A:200 -- 552
:738

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bhwA           ----------------------------------------------------------------------
1zy9A2          ----------------------------------------------------------------------
1a0cA           ----------------------------------------------------------------------
1hp4A1          ----------------------------------------------------------------------
1we5A4          ----------------------------------------------------------------------
1ktbA2          ----------------------------------------------------------------------
2ot9A1          ----------------------------------------------------------------------
1m7xA3          ----------------------------------------------------------------------
1al0G           ----------------------------------------------------------------------
1wp0A1          ----------------------------------------------------------------------
2aaaA2          ----------------------------------------------------------------------
1dhrA           ----------------------------------------------------------------------
1nouA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bhwA           ----------------------------------------------------------------------
1zy9A2          ----------------------------------------------------------------------
1a0cA           ----------------------------------------------------------------------
1hp4A1          ----------------------------------------------------------------------
1we5A4          ----------------------------------------------------------------------
1ktbA2          ----------------------------------------------------------------------
2ot9A1          ----------------------------------------------------------------------
1m7xA3          ----------------------------------------------------------------------
1al0G           ----------------------------------------------------------------------
1wp0A1          ----------------------------------------------------------------------
2aaaA2          ----------------------------------------------------------------------
1dhrA           ----------------------------------------------------------------------
1nouA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bhwA           ----------------------------------------------------------------------
1zy9A2          ----------------------------------------------------------------------
1a0cA           ----------------------------------------------------------------------
1hp4A1          ----------------------------------------------------------------------
1we5A4          ----------------------------------------------------------------------
1ktbA2          ----------------------------------------------------------------------
2ot9A1          ----------------------------------------------------------------------
1m7xA3          ----------------------------------------------------------------------
1al0G           ----------------------------------------------------------------------
1wp0A1          ----------------------------------------------------------------------
2aaaA2          ----------------------------------------------------------------------
1dhrA           ----------------------------------------------------------------------
1nouA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxYSSSPQQNPFFMLSRRETTEHSGEVYGFNFIYSGNFQNMIEVDHFDTARVTVGINPVE
1bhwA           ----------------------------------------------------------------------
1zy9A2          ----------------------------------------------------------------------
1a0cA           ----------------------------------------------------------------------
1hp4A1          ----------------------------------------------------------------------
1we5A4          ----------------------------------------------------------------------
1ktbA2          ----------------------------------------------------------------------
2ot9A1          ----------------------------------------------------------------------
1m7xA3          ----------------------------------------------------------------------
1al0G           ----------------------------------------------------------------------
1wp0A1          ----------------------------------------------------------------------
2aaaA2          ----------------------------------------------------------------------
1dhrA           ------------YGMAKGAVHQLCQSLAGKNSGMPSGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEF
1nouA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           FRFLLNPAESFVTPEAIVIYSDQGMNQMSQQLSDFYRHHLVNPNFSQASRPIILNSWETFYFDLGTEKIL
1bhwA           ------------------------FKKALDETGLIVPMVTTNLFTHPVFKDGGFTSNDRSVRRYAIRKVL
1zy9A2          -----------------------------------------------------WCSWYHYFLDLTWEETL
1a0cA           -----------------------------------TKVLWGTANSNPRFVHGASTSCNADVFAYSAAQVK
1hp4A1          ----------------------------------------------------------RHFFGVDEKRYI
1we5A4          -----------------------------------------------------LTTSFTTNYDEATVNSF
1ktbA2          -------------------------------------------------PPMGWLAWERFRCNVNCRLFM
2ot9A1          ----------------------------------------------------------------------
1m7xA3          ----------------------------------------------------------------------
1al0G           --------------------------------------------------------LQTPKATSSTLYFD
1wp0A1          -------------------------------------------------QWLLIYFGFTHCPDVCPEELE
2aaaA2          ----------------------------------IYFLLTDRFGRTDNSTTATCNTGNEIYCGGSWQGII
1dhrA           LHDWITGNKRPNSGSLIQVVTTDGKTEL------------------------------------------
1nouA1          -------------------------------------------------------LIDTSRHYLPVKIIL


                         .         .         .         .         *         .         .:420
query           DLAKAAKDLGIELFVLDDGWFGHRKDDKSSLGDWVTDRSRLPEGIGFLADEIHKIGLQFGLWFEPEMISI
1bhwA           RQMDLGAELGAKTLVLWGGREGAEYDSAK---DVSAALDRYREALNLLAQYSEDRGYGLRFAIEPKPNEP
1zy9A2          KNLKLAKNFPFEVFQIDDAYEKDIGDWLVTRGDF--------PSVEEXAKVIAENGFIPGIWTAPFSVSE
1a0cA           KALEITKELGGENYVFWGGREGYETLLN---TDMEFELDNFARFLHMAVDYAKEIGFEGQFLIEPKPKEP
1hp4A1          DRVARYKYNKLHLHLSDDQGWRIAIDSWPRLATYGGSTEYTKAEYKEIVRYAASRHLEVVPEIDMPGHTN
1we5A4          IDGXAERNLPLHVFHFDCFW---XKAFQWCDFEWDPLTFPDPEG---XIRRLKAKGLKICVWINP-YIGQ
1ktbA2          EMADRIAEDGWKYINIDDCWAAKQRDAE---GRLVPDPERFPRGIKALADYVHARGLKLGIYGDLGRLTC
2ot9A1          -------------------------LDRGVYESVKQTIARHPSETEERX-TVRLLAYAFWYNEQLAFGRL
1m7xA3          ------KWMGFTLELLPINEHPFDGSWGYQPTGLPTRRFGTRDDFRYFIDAAHAAGLNVILDWVPGHFPT
1al0G           SLTVAGNGGFLHCIQMDTSVN-------AANQVVSVGADIAFDADPKFFACLVRFESSSVPTTLPTAYDV
1wp0A1          KXIQVVDEIDSITTLPDLTPLFISIDPERDTKEAI-ANYVKEFSPKLTREEVDQVARAYRVYYSPGPKDE
2aaaA2          DHLDYIEGMGIWISPITEQLPQDTADGEAYHGYWQQKIYDVADNLKSLSDALHARGMYLMVDVVPDHMGY
1dhrA           ----------------------------------------------------------------------
1nouA1          KTLDAMAFNKFNVLHWHIVDDQSFPYQSITFPELSNKGSYSLSHVYTPNDYARLRGIRVLPEFDTPGHTL


                         .         .         +         .         .         .         .:490
query           DSDLYKNHADWTIHLLDREKSVGRNQYVLDLTRQEVVDYLFDSISKIIIKTNLDYIKWDMNRHITDIYSI
1bhwA           RGDILLPTAGHAIAFVQELERPELFGINPETGNEQMSNLNFTQGIAQ-------ALWHKKLFHIDLNGQH
1zy9A2          TSDVFNEHPDWVVKENGEPKXAYRNIYALDLSKDEVLNWLFDLF-SSLRKXGYRYFKIDFLFAGAVPGER
1a0cA           TKHQYDFDVANVLAFLRKYDLDKYFKVNIEANHATLAFHDFQHELRYARI-NGVLGSIDANTGDMLLG--
1hp4A1          AALASYAELNCDGVAPPLYTGTKVGFSSLCVDKDVTYDFVDDVIGELAALTPGRYLHIGGDEAHSTPK--
1we5A4          KSPVFKELQEKGYLLKRPDGSLWQGLAIYDFTNPDACKWYADKL-KGLVAXGVDCFKTDFGRIPTDVQWF
1ktbA2          GGYPGTTLDRV------------------------------EQDAQTFAEWGVDMLKLDGCYSSGKEQ--
2ot9A1          DDRVLHWIEVGQPDADRLTWCSRRTERTSLLAYGSLRVWEGKVIPAIKNLKNVNIAAVPQDVLE------
1m7xA3          DDFALAEFDGTNLYEHS--------TLIYNYGRREVSNFLVGNALYWIERFGIDALRVDAVASMIYRGGR
1al0G           YPLNGRHDGGYYTVKDCVTI--------------------------------------------------
1wp0A1          DED-YIVDHTIIXYLIGPDGEF-LDYFGQNKRKGEIAASI------------------------------
2aaaA2          AGNGSSSYFHPYCLITDWDNLTMVEDCWLDTTETAVRTIWYDWVADLVSNYSVDGLRIDSVLEV------
1dhrA           ----------------------------------------------------------------------
1nouA1          SW-------GKGQKDLLTPCYSLDSFGPINPTLNTTYSFLTTFFKEISEVFPDQFIHLGGDEVEFKCWES


                         *         .         .         .         .         +         .:560
query           ELDSEQQMEFGHRYILGLYQLLDRLITKFPSVLFESCSSGGGRFDLGLMYYAPQAWTSDDTDPIERLKIQ
1bhwA           GPKFDQDLVFGHGDLLNAFSLVDLLENGPD----------GAPAYDGPRHFDYKPSRTEDYDGVWESAKA
1zy9A2          KKNITPIQAFRKGIETIRKAVGEDSF--ILGCGSPLLPAVGCVDGXRIGPDTAPFWGEHIEDNGAPAARW
1a0cA           -WDTDQFPTDIRMTTLAMYEVIKMGGFDKGGLNFDAK-----VRRASFEPEDLFLGHIAGMDAFAKG---
1hp4A1          -----------ADFVAFMKRVQPIVAKYGKTVVGWHQLAGAEVEGALVQYWGLDRTGDAEKAEVAEARNG
1we5A4          DGSDPQKXHYAYIYNELVWNVLKDTVGEEEAVLFRSASVGAQKF--------PVHWGGD-----------
1ktbA2          -AQGYPQMARALNATGRPIVYSCSWPAYQGGLPPKVNYTLLGEICNLWRNYDDIQDSWDSVLSIVDWFFT
2ot9A1          ----------------------------------------------------------------------
1m7xA3          ENLEAIEFLRNTNRILGEQVSGAVTMATDFPGVSRPQDMGGLGFWYKWLGWMHDTLDYMKLDPVYRQYHH
1al0G           ----------------------------------------------------------------------
1wp0A1          ----------------------------------------------------------------------
2aaaA2          ----------------------------------------------------------------------
1dhrA           ----------------------------------------------------------------------
1nouA1          NPKIQDFMRQKGFGSFYIQKVLDIIATINKGSIVWQEVFDDKAKLAPGTIV--EVWKDSAYPEELSRVTA


                         .         .         .         *         .         .         .:630
query           HGTSYGYSPSMMTAHVSISPNEQSGRQTSLDTRTNVAYFSSFGYELDVTRLSVEEKEQVREQIQFYKKYR
1bhwA           NIRMYLLLKERAKAFRADPEVQEALAASKVAELKTPTLNPGEGYAELLADRSAFEDYDADAVGAKGFGFV
1zy9A2          ALRNAITRYFXHDRFWLNDPDCLILREEKTDLTQKEKEL-------------------------------
1a0cA           ----------------------------------------------------------------------
1hp4A1          TGLILSPADRTYLDMKYTKDTPLGLSWAGYVEVQRSYDW-------------------------------
1we5A4          ----------------------------------------------------------------------
1ktbA2          NQDVLQPFAGPGHWNDPDMLIIGNFGLSYEQSRSQMALWTIMAAPL------------------------
2ot9A1          ----------------------------------------------------------------------
1m7xA3          DLTFGILYNYTENFVLPLSHDEVVHGKKSILDRMP-----------------------------------
1al0G           ----------------------------------------------------------------------
1wp0A1          ----------------------------------------------------------------------
2aaaA2          ----------------------------------------------------------------------
1dhrA           ----------------------------------------------------------------------
1nouA1          SGFPVILSAPWYL---------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           SLFQYGDFYRINxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bhwA           KLNQLAIEHLLG----------------------------------------------------------
1zy9A2          ----------------------------------------------------------------------
1a0cA           ----------------------------------------------------------------------
1hp4A1          ----------------------------------------------------------------------
1we5A4          ----------------------------------------------------------------------
1ktbA2          ----------------------------------------------------------------------
2ot9A1          ----------------------------------------------------------------------
1m7xA3          ----------------------------------------------------------------------
1al0G           ----------------------------------------------------------------------
1wp0A1          ----------------------------------------------------------------------
2aaaA2          ----------------------------------------------------------------------
1dhrA           ----------------------------------------------------------------------
1nouA1          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bhwA           --------------------------------------
1zy9A2          --------------------------------------
1a0cA           --------------------------------------
1hp4A1          --------------------------------------
1we5A4          --------------------------------------
1ktbA2          --------------------------------------
2ot9A1          --------------------------------------
1m7xA3          --------------------------------------
1al0G           --------------------------------------
1wp0A1          --------------------------------------
2aaaA2          --------------------------------------
1dhrA           --------------------------------------
1nouA1          --------------------------------------