[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF55041.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1q35A.bssp"
#ERROR : Can't open dsspfile "1d9vA.bssp"
#ERROR : Can't open dsspfile "1xvxA.bssp"
#ERROR : Can't open dsspfile "1y4tA.bssp"
#ERROR : Can't open dsspfile "1potA.bssp"
#ERROR : Can't open dsspfile "1a99A.bssp"
#ERROR : Can't open dsspfile "1urdA.bssp"
#ERROR : Can't open dsspfile "1eu8A.bssp"
#ERROR : Can't open dsspfile "1a7lA.bssp"
#ERROR : Can't open dsspfile "2onkE1.bssp"
#ERROR : Can't open dsspfile "1atgA.bssp"
#ERROR : Can't open dsspfile "1eljA.bssp"
#ERROR : Can't open dsspfile "1j1nA.bssp"
#ERROR : Can't open dsspfile "1twyA.bssp"
#ERROR : Can't open dsspfile "1sbpA.bssp"
#ERROR : Can't open dsspfile "1amfA.bssp"
#ERROR : Can't open dsspfile "2ajfE1.bssp"
#ERROR : Can't open dsspfile "1ohfA.bssp"

## Summary of PDB Search
:202
    3e-28  26%  1q35A  [c.94.1.1] IRON BINDING PROTEIN FBPA
    1e-25  24%  1d9vA  [c.94.1.1] PROTEIN (IRON-UTILIZATION PERIPLASMIC PROTEIN)
    2e-21  25%  1xvxA  [c.94.1.1] YFUA
    5e-18  26%  1y4tA  [c.94.1.1] PUTATIVE IRON-UPTAKE ABC TRANSPORT SYSTEM
    3e-16  17%  1potA  [c.94.1.1] SPERMIDINE/PUTRESCINE-BINDING PROTEIN
    2e-11  15%  1a99A  [c.94.1.1] PUTRESCINE-BINDING PROTEIN
    3e-10  12%  1urdA  [c.94.1.1] MALTOSE-BINDING PROTEIN
    3e-09  15%  1eu8A  [c.94.1.1] TREHALOSE/MALTOSE BINDING PROTEIN
    2e-08  17%  1a7lA  [c.94.1.1] MALE-B363
    2e-08  22%  2onkE1 [c.94.1.1] MOLYBDATE/TUNGSTATE BINDING PROTEIN E:32 -- 342
    1e-07  13%  1atgA  [c.94.1.1] PERIPLASMIC MOLYBDATE-BINDING PROTEIN
    1e-06  12%  1eljA  [c.94.1.1] MALTODEXTRIN-BINDING PROTEIN
    1e-05   9%  1j1nA  [c.94.1.1] ALGQ2
    4e-05  10%  1twyA  [c.94.1.1] ABC TRANSPORTER, PERIPLASMIC SUBSTRATE-BINDING
    1e-04  28%  1sbpA  [c.94.1.1] SULFATE-BINDING PROTEIN
    2e-04  19%  1amfA  [c.94.1.1] MOLYBDATE TRANSPORT PROTEIN MODA
    5e-04   8%  2ajfE1 [d.318.1.1] SARS-CORONAVIRUS SPIKE PROTEIN E:323 -- 502
    6e-04  14%  1ohfA  [b.121.4.8] NUDAURELIA CAPENSIS OMEGA VIRUS CAPSID PROTEIN
:202

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxLVVYSPNSEGLIGATIPAFEEKYGIKIELIQAGTGELFKKL
1q35A           -----------------------------VNVYSYRQPYLIEPMLKNFEKDTGIKVNIIFA--DGLVDRV
1d9vA           -----------------------------ITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQL
1xvxA           -----------------------------IVVYNAQHENLVKSWVDGFTKDTGIKVTLRNGGDSELGNQL
1y4tA           -----------------------------LNIYSARHYNADFEIIKKFEEKTGIKVNHTQAKASELIKRL
1potA           -----------------------------LYFYNWTEY-VPPGLLEQFTKETGIKVIYSTYESNETMYAK
1a99A           -----------------------------LHIYNWSDYIA-PDTVANFEKETGIKVVYDVFDSNEVLEGK
1urdA           -----------------------------WSWQTGPELQDVKQIAAQWAKAHGDKIVVDQSSNPKGFQFY
1eu8A           -----------------------------AVGGAPNEIEYWKGVIAEFEKKYGVTVELKRQATDRRLDLV
1a7lA           -----------------------------LVIWIDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEKFPQV
2onkE1          -----------------------------LKVFHAGSTEPMKAFKRAFEEKHNVEVQTEAAGSAATIRKV
1atgA           -----------------------------LKVVTATNLGTLEQLAGQFAKQTGHAVVISSGSSGPVYAQI
1eljA           -----------------------------VVIWQPNELEVFQSLAEEYMALPEVEIVFEQKPNLEDALKA
1j1nA           -----------------------------LKIHMKWVWDENWPVAKESFRLTNVKLQSVANKAATNSQNL
1twyA           ------------------------------ISGSTSVARIXDVLAEKYNQQHETYVAVQGVGSTAGISLL
1sbpA           -----------------------------NVSYDPTRE-LYEQYNKAFSAHWNVVIDQSHGGSGKQATSV
1amfA           --------------------------------------------ATQFKKEKGVDVVSSFASSSTLARQI
2ajfE1          ------------------------------------------DDVRQIAGQTGVIADYNYKLPDDMGCVL
1ohfA           -----------------------------LDIDQDSIGWYFKYLDPAGATESRAVGEYSKIPDGLVKFSV


                         .         .         *         .         .         .         .:140
query           ESEKEVPVADVIFGGSYTQYATHGELFENYISKENDNVIKEYQNTTGFSTPYTLDGSVLIVHPDLTKGMN
1q35A           KQEGELSPADVLLTVSRVMEIVNADLAQKIDSKVLEKNIAQFRDSNDQWFGLTTRARVIYTSKDRVGKLA
1d9vA           KEEGDKTPADVFYTEQTATFADLSELLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSE
1xvxA           VQEGSASPADVFLTENSPVLVDNAKLFAPLDAVTQAQVAQEYRPEHGRWTGIAARSTVFVYNPEISEAEL
1y4tA           SLEGSNSPADIFITADISNLTEAKNLLSPVSSKYLEEFIAHLRDKDKEWFAITKRARIIAYNKNTNIDIS
1potA           LKTYKDGAYDLVVPSTYYKMRKEGMIIDKSKLTNFSNLDPDMLNKPFYSIPYIWGATAIGVNGDAVDPKS
1a99A           LMAGSTGFDLVVPSASFLERQLTAGVFQPLDKSKLPEWKNLHDPDNKFAMPYMWATTGIGYNVDKVKNAP
1urdA           ATAARTGGPDVVFGMPHGVFAEEGLMAPVPSGVLNTGIDAIKVNGTMYSVPVSVQVAAIYYNKKLVP-QP
1eu8A           NALRGKSSDPDVFLMDVAWLGQFIAYVQKDNYDLSVFFQSVKQGGKLYALPVYIDAGLLYYRKDLLEKYG
1a7lA           AATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPRYNGKLIAYPIAVEALSLIYNKDLLPNPP
2onkE1          TELGR--KADVIATADYT-----------------LIQKMMYPEFANWTIMFAKNQIVLAYRNDSRYADE
1atgA           VNGA---PYNVFFSADEKSP---------------EKLDNQGFALPGSRFTYAIGKLVLWSAKP---GLV
1eljA           AIPTGQGPDLFIWAHDWIGKFAEAGLLEPIDEYVTEDLLNEQYKGHYYALPFAAETVAIIYNKEMVS-EP
1j1nA           MMASGDLPDVVGGDNLKDKFIQYGVPLNKLIDQYAPHIKAFFKSPEVERAIKAPDGNGYFIREDWLKLKP
1twyA           KKG-VADIAXTSRYLTESEAQNTLHTFTLAFD--------GLAIVVNQANPVTNLTREQLYGI---YKGQ
1sbpA           INGIE---ADTVLALAYNAIAERGRIDKNWIKRLPDD-----------SAPYTS-TIVFLVRKGNPK--Q
1amfA           EAGAP---ADLFISADQK--------WMDYAVDKKAIDTATRQTLLG--------NSLVVVAPSVQKDFT
2ajfE1          AWNTRNIDATSTGNYNYKYRYLRHGKLRISNVPFSPDGKPCTPPALNCYWPYGFYTTGIGYQPYRVVVLS
1ohfA           DAE-------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           IEGYSDLLKPELKGKIATADPANSSSAFAQLTNMLQAQGGYKDDKAWSYVKDLFTLIDGIVx
1q35A           GFDYLDLAKPEYKGKVCVRSGKNSYNV-SLFAAMIEHYG---IEKTKAFLEGL---------
1d9vA           EKSVLDYATPKWKGKIGYVST--SGAFLEQVVALSKMKG---DKVALNWLKGL---------
1xvxA           PKSIMDLAKPEWKGRWAASPSGADFQAI--VSAMLELKG---EKATLEWLKAM---------
1y4tA           MKNYEDLAKAEFKGEIVMRSAT--APYSKTLLASIIANDGNKEAKAW---------------
1potA           VTSWADLWKPEYKGSLLLTDDAREVFQMALRKLGYSG-NTTDPKEIEAAYNELKKLMPNVA-
1a99A           VDSWDLILKPENLEKLKSCGVSFLDAPEEVFATVLNYLGKDPNSTKAD--------------
1urdA           PQTWAEFVKDANAHGFMYDQANLYFDYAIIGGYGGYVFKDNNGT------------------
1eu8A           YSKWQELVEMAQKIQSGERETNPNFWGFVWQGKQYEGLVCDFVEYVYSNGGSLGEFKDG---
1a7lA           KEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVD-------
2onkE1          INSYEILKRPDV--RFGFSNPNDDPCGYRSLMAIQLAELYYNDPTIFDEL------------
1atgA           DNQGKVLAGNGWRHIAIS--NPQIAPYGLAGTQVLTHLGLLDKLTAQ---------------
1eljA           PKTFDEMKAIMEKYYDPANEGIAWPINAYFISAIAQAFGGYYFDDKTEQPG-----------
1j1nA           PQNIDELYTVLKAFKEKDPNGNGKADEVP---------------------------------
1twyA           ITNWKQVGGND--QKIAVVTREASSGTRYSFESLXGLTKTVKDREVSDVAPTA---------
1sbpA           IHDWNDLIKPGV--SVITPNPKSSGGAYLAAWGYALHHNNNDQAKAEDFVKALF--------
1amfA           IDSKTNWTSLLNGGRLAVGDPE----------------------------------------
2ajfE1          FE------------------------------------------------------------
1ohfA           --------------------------------------------------------------