[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF55075.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1f6vA.bssp"
#ERROR : Can't open dsspfile "1xd7A.bssp"
#ERROR : Can't open dsspfile "2b0lA1.bssp"
#ERROR : Can't open dsspfile "1omiA2.bssp"
#ERROR : Can't open dsspfile "2cohA1.bssp"
#ERROR : Can't open dsspfile "1zybA1.bssp"
#ERROR : Can't open dsspfile "1qbjA.bssp"
#ERROR : Can't open dsspfile "1z05A1.bssp"

## Summary of PDB Search
:145
    2e-09  12%  1f6vA  [a.49.1.1] DNA TRANSPOSITION PROTEIN
    3e-07  39%  1xd7A  [a.4.5.55] YWNA
    3e-05  22%  2b0lA1 [a.4.5.66] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC A:167
    3e-04  19%  1omiA2 [a.4.5.4] LISTERIOLYSIN REGULATORY PROTEIN A:1138 -- 1237
    7e-04  22%  2cohA1 [a.4.5.4] TRANSCRIPTIONAL REGULATOR A:118 -- 199
    7e-04  27%  1zybA1 [a.4.5.4] TRANSCRIPTION REGULATOR, CRP FAMILY A:148 -- 220
    7e-04  20%  1qbjA  [a.4.5.19] PROTEIN (DOUBLE-STRANDED RNA SPECIFIC ADENOSINE
    9e-04  17%  1z05A1 [a.4.5.63] TRANSCRIPTIONAL REGULATOR, ROK FAMILY A:10 --
:145

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxIATHMLIIIALEGKESKVTSDFLAASVGVNPVIIRKILSQLKKAELISVARGTGGTEIVKDL
1f6vA           -----------RIAKRTAIN-KTKKADVKAIADAWQINGEKELELLQQI---------AQKPGNHSLRLA
1xd7A           --------LAVAIHILSLISMDEKTSSEI-IADSVNTNPVVVRRMISLLKKADILTSRAGVPGASLKKDP
2b0lA1          -------------HIFEELDGNEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGTYIKVL
1omiA2          --------ICGQLLILTYVYGKETPGIKITLDNLTMQELSAVSRIISKLKQEKVIVYKNSCFLKRYAPKL
2cohA1          ------------PLAHEEEGKVVLKATHDELAAAVGSVRETVTKVIGELAREGYIRSGYGKI--QLLDLK
1zybA1          -------------HCEKPQGEKTFKVKXDDLARCLDDTRLNISKTLNELQDNGLIELHRKEI--------
1qbjA           --------QEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPP-------
1z05A1          ---------------VYKLIDQKGPISRIDLSKESELAPASITKITRELIDAHLIHETTVQEAISRGRPA


                         .         .         *         .         .         .         .:140
query           KDISLLDVYQAVECLGKTGQLFSFHDNPNPNCPVGAHIHDVLDQKLERIQLTMEAELGQTSLEKVVxxxx
1f6vA           AMTAHGKGERVNE---DYLRQAFRELDLDVDI--------------------------------------
1xd7A           ADISLLEVYRAVQKNPKC--------------PVGKKIQNALDETFESVQRAMENELASKSLKDVM----
2b0lA1          NNKFLIELEN------------------------------------------------------------
1omiA2          DEWFYLACPATWGKL-------------------------------------------------------
2cohA1          GLKELAESR-------------------------------------------------------------
1zybA1          ----------------------------------------------------------------------
1qbjA           ----------------------------------------------------------------------
1z05A1          VGLQT-----------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxx
1f6vA           -----
1xd7A           -----
2b0lA1          -----
1omiA2          -----
2cohA1          -----
1zybA1          -----
1qbjA           -----
1z05A1          -----