[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF55169.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1c4tA.bssp"
#ERROR : Can't open dsspfile "1b5sA.bssp"
#ERROR : Can't open dsspfile "1ciaA.bssp"
#ERROR : Can't open dsspfile "1j27A.bssp"
#ERROR : Can't open dsspfile "1balA.bssp"
#ERROR : Can't open dsspfile "1ebdC.bssp"
#ERROR : Can't open dsspfile "1balA.bssp"
#ERROR : Can't open dsspfile "1ebdC.bssp"

## Summary of PDB Search
:347
    8e-76  36%  1c4tA  [c.43.1.1] PROTEIN (DIHYDROLIPOAMIDE SUCCINYLTRANSFERASE)
    2e-74  35%  1b5sA  [c.43.1.1] DIHYDROLIPOAMIDE ACETYLTRANSFERASE
    8e-46  17%  1ciaA  [c.43.1.1] CHLORAMPHENICOL ACETYLTRANSFERASE
    2e-17  12%  1j27A  [d.58.50.1] HYPOTHETICAL PROTEIN TT1725
    8e-12  29%  1balA  [a.9.1.1] DIHYDROLIPOAMIDE SUCCINYLTRANSFERASE
    1e-10  44%  1ebdC  [a.9.1.1] DIHYDROLIPOAMIDE ACETYLTRANSFERASE
    3e-09  36%  1balA  [a.9.1.1] DIHYDROLIPOAMIDE SUCCINYLTRANSFERASE(query 49->87)
    6e-08  33%  1ebdC  [a.9.1.1] DIHYDROLIPOAMIDE ACETYLTRANSFERASE(query 52->87)
:347

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xADDKLRATPAARKLADDLGINLYDVSGSGANGRVHKEDVETYxxxxxVRISPLAKRIALEHNIAWQEIQ
1c4tA           ----------------------------------------------------------------------
1b5sA           ----------------------------------------------------------------------
1ciaA           ----------------------------------------------------------------------
1j27A           ----------------------------------------------------------------------
1balA           -EQNNDALSPAIRRLLAEHNLDASAIKGTGVGGRLTREDVEKH---------------------------
1ebdC           -------AMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDIDAF---------------------------
1balA           ------------------------------------------------DALSPAIRRLLAEHNLDASAIK
1ebdC           ---------------------------------------------------MPSVRKYAREKGVDIRLVQ


                         .         .         *         .         .         .         .:140
query           GTGHRGKIMKKDVLALLxxxxxxxxxxxxxxxxxxxEVPDNVTPYGKIERIPMTPMRKVIAQRMVESYLT
1c4tA           ----------------------------------------------------RVPMRKRVAERLLEAKNS
1b5sA           ------------------------------------AKPATTEGEFPETREKMSGIRRAIAKAMVHSKHT
1ciaA           ---------------------------------------------------------------HFEFYRH
1j27A           ----------------------------------------------------------------------
1balA           ----------------------------------------------------------------------
1ebdC           ----------------------------------------------------------------------
1balA           GTGVGGRLTREDVEKHL-----------------------------------------------------
1ebdC           GTGKNGRVLKEDIDAFL-----------------------------------------------------


                         +         .         .         .         .         *         .:210
query           APTFTLNYEVDMTEMLALRKKVLEPIMEATGKKTTVTDLLSLAVVKTLMKHPYINASLTEDGKTIITHNY
1c4tA           TAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFYVKAVVEALKRYPEVNASI--DGDDVVYHNY
1b5sA           APHVTLMDEADVTKLVAHRKK-FKAIAAEKGIKLTFLPYVVKALVSALREYPVLNTSIDDETEEIIQKHY
1ciaA           RCGFSLTSKIDITTLKKSLDD----------SAYKFYPVMIYLIAQAVNQFDELRMAIKDDE--LIVWDS
1j27A           --------KAYLGLYTARLET-------PARSLKEKRALIKPALERLKARFPVSAARLYGL----DAWGY
1balA           ----------------------------------------------------------------------
1ebdC           ----------------------------------------------------------------------
1balA           ----------------------------------------------------------------------
1ebdC           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VNLAMAVGMDNGLMTPVVYNAEKMSLSELVVAFKDVIGRTLDGKLAPSELQNSTFTISNLGMFGVQSFGP
1c4tA           FDVSMAVSTPRGLVTPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTP
1b5sA           YNIGIAADTDRGLLVPVIKHADRKPIFALAQEINELAEKARDGKLTPGEMKGASCTITNIGSAGGQWFTP
1ciaA           VDPQFTVFHQETETFSALSCPYSSDIDQFMVNYLSVMERKSDTKLFPQGTPENHLNISALPWVNFDSFNL
1j27A           EVVGFTLGNDPAWVEETMRAAARFLAEAG-----------------------------------------
1balA           ----------------------------------------------------------------------
1ebdC           ----------------------------------------------------------------------
1balA           ----------------------------------------------------------------------
1ebdC           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           IINQPNSAILGVSSTIEKPVVVNGEIVIRPIMSLGLTIDHRVVDGMAGAKFMKDLKELIETPISMLI
1c4tA           IINPPQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLL-
1b5sA           VINHPEVAILGIGRIAEKPIVRDGEIVAAPMLALSLSFDHRMIDGATAQKALNHIKRLLSDPELLLM
1ciaA           NVANFTDYFAPII-TMAKYQQEGDRLL----LPLSVQVHQAVCDGFHVARFINRLQELCNSK-----
1j27A           -------------------------------------------------------------------
1balA           -------------------------------------------------------------------
1ebdC           -------------------------------------------------------------------
1balA           -------------------------------------------------------------------
1ebdC           -------------------------------------------------------------------