[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF55178.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1nw1A.bssp"
#ERROR : Can't open dsspfile "2oi8A2.bssp"
#ERROR : Can't open dsspfile "1mruA.bssp"
#ERROR : Can't open dsspfile "1nd4A.bssp"
#ERROR : Can't open dsspfile "1v30A.bssp"
#ERROR : Can't open dsspfile "1tklA.bssp"
#ERROR : Can't open dsspfile "1zylA1.bssp"
#ERROR : Can't open dsspfile "1yvpA1.bssp"
#ERROR : Can't open dsspfile "1k25A1.bssp"
#ERROR : Can't open dsspfile "1djnA2.bssp"
#ERROR : Can't open dsspfile "2peiA1.bssp"
#ERROR : Can't open dsspfile "1zelA2.bssp"
#ERROR : Can't open dsspfile "2ppqA1.bssp"
#ERROR : Can't open dsspfile "1b6cB.bssp"
#ERROR : Can't open dsspfile "1t4hA.bssp"
#ERROR : Can't open dsspfile "1ia8A.bssp"
#ERROR : Can't open dsspfile "1fo8A.bssp"
#ERROR : Can't open dsspfile "1usuB.bssp"
#ERROR : Can't open dsspfile "1b49A.bssp"
#ERROR : Can't open dsspfile "1gosA2.bssp"
#ERROR : Can't open dsspfile "1zkeA1.bssp"
#ERROR : Can't open dsspfile "1b0pA4.bssp"
#ERROR : Can't open dsspfile "1r4vA.bssp"

## Summary of PDB Search
:543
    3e-23   6%  1nw1A  [d.144.1.8] CHOLINE KINASE (49.2 KD)
    7e-22  10%  2oi8A2 [a.121.1.1] PUTATIVE REGULATORY PROTEIN SCO4313 A:87 -- 216
    2e-19  42%  1mruA  [d.144.1.7] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNB
    7e-18  17%  1nd4A  [d.144.1.6] AMINOGLYCOSIDE 3'-PHOSPHOTRANSFERASE
    3e-13  10%  1v30A  [d.269.1.1] HYPOTHETICAL UPF0131 PROTEIN PH0828
    1e-12   8%  1tklA  [d.248.1.1] COPROPORPHYRINOGEN III OXIDASE
    4e-12  11%  1zylA1 [d.144.1.6] HYPOTHETICAL PROTEIN YIHE A:4 -- 328
    1e-09  11%  1yvpA1 [a.118.25.1] 60-KDA SS-A/RO RIBONUCLEOPROTEIN A:5 -- 363
    2e-09  17%  1k25A1 [d.11.1.1] LOW-AFFINITY PENICILLIN-BINDING PROTEIN 2X A:632
    2e-09  15%  1djnA2 [c.3.1.1] TRIMETHYLAMINE DEHYDROGENASE A:490 -- 645
    5e-09   9%  2peiA1 [a.280.1.1] ORF134 A:3 -- 109
    8e-09  13%  1zelA2 [d.377.1.1] HYPOTHETICAL PROTEIN RV2827C A:83 -- 294
    9e-09   9%  2ppqA1 [d.144.1.6] HOMOSERINE KINASE A:5 -- 320
    9e-09  24%  1b6cB  [d.144.1.7] TGF-B SUPERFAMILY RECEPTOR TYPE I
    4e-08  22%  1t4hA  [d.144.1.7] SERINE/THREONINE-PROTEIN KINASE WNK1
    9e-08  26%  1ia8A  [d.144.1.7] CHK1 CHECKPOINT KINASE
    1e-07   9%  1fo8A  [c.68.1.10] ALPHA-1,3-MANNOSYL-GLYCOPROTEIN BETA-1,2-N-
    4e-07  12%  1usuB  [d.83.2.1] AHA1
    5e-07   6%  1b49A  [d.117.1.1] PROTEIN (DEOXYCYTIDYLATE HYDROXYMETHYLASE)
    1e-06   8%  1gosA2 [d.16.1.5] MONOAMINE OXIDASE A:290 -- 401
    1e-06   7%  1zkeA1 [a.30.6.1] HYPOTHETICAL PROTEIN HP1531 A:1 -- 79
    2e-06   9%  1b0pA4 [c.64.1.1] PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE)
    4e-04  18%  1r4vA  [a.22.1.4] HYPOTHETICAL PROTEIN AQ_328
:543

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MGQILLAMRLAHTRGIVHRDLKPQNILLTPDGTAKVTDFGIAVAFAETSLTQTNSMLGSVHYLSPEQARG
1nw1A           EFLRAHISLSKSPVTFCHNDLQEGNILLPKRLVLIDFEYASYNYRAFDFANHFIEWTIDYDIDEAPFYKI
2oi8A2          HALRAWALDDPQRYFLIFGTPVPGYRAPDDITEIETXAVIVD-ACAAGTDGAFDAHLDTHRQWADRPAPS
1mruA           IADACQALNFSHQNGIIHRDVKPANIMISATNAVKVMDFGIARAIT-------------AQYLSPEQARG
1nd4A           FARLKARMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLG-VADRYQDIALATRDIAEELGGEWADR
1v30A           ---------------------------------TLRKGKPLHWYLKGAFLGEDWIEGYQLYFEYLPYAVK
1tklA           YFYITHRKETRGIGGIFFDDYDERDPQEILKMVEDCFDAFLP-SYLTIVKRRKDMPYTKEEQQWQAIRRG
1zylA1          --AVTAHWREDFTVLRLHGDCHAGNILWRDGPMFVDLDDARNGPAVQDLWMLLNGDKAEQRMQLETEEFS
1yvpA1          LNLAMAVTKYKQRNGWSHKDLLRLSIKPANEGLTMVAKYVSKGWKEVQEAYKEKELSPETKYLEATEKRT
1k25A1          ----------------------------------------------------------------------
1djnA2          AGHEVTIVSGVHLANYMHFTLEYPNMMLHELHVEELGDHFCSIEPGRMEIYNIWGDGSKRTYRGPGVSPR
2peiA1          RHPIQESDLYLEAXXLENKELVLRILTVRENLAEGVLEFLPEXVLSQIKQSNGNHR--------------
1zelA2          -----------PLRSWLARDQNAGFMLAGASAAWHLGYLDRDGRIPIWLPPAKRLPDGLASYVSVVRIPW
2ppqA1          ------------------------------------------------------------CFEKDGAYNV
1b6cB           AHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTIDKRYMAPEVLDDSINMKH
1t4hA           CRQILKGLQFLHTRTIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKAVIG--TPEFXAPEXYEE
1ia8A           FHQLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLLKMCGTLPYVAPELLKR
1fo8A           --SYGSAVTHIRQPDLSNIAVQPDHRKFQGYYIARHYRWALGQIFHNAAVVVEDDL--EVAPDFFEYFQA
1usuB           ----------------VDK-----NCIGWAKEYFKQKIVGVEAKK-YAKIKSVSSIEGDCEV-----NQR
1b49A           KGEINSNYGWAIWSEDNYAQYDMCLAELQNPDSRRGIMIYTRPSMQFDYMSDFMCTNTVQYLIRDKKINA
1gosA2          --------------------------------------LGSVIKCIKEPFWRKKDYCGTMIIDGEEAPVA
1zkeA1          FTQLSEEVERLKELINALNKIKKGLLVF------------------------------------------
1b0pA4          RADYVACHNAYVGIYDILEGIKDGGTFVLNSPWSSLEDMDKHLPSGIKR-TIANKKLKFYNIDAVKIATD
1r4vA           -----LLLXHADVIKKATGERKPSR--EAXEFVAQIVDKVF-----------------------------


                         .         .         *         .         .         .         .:140
query           SKATVQSDIYAMGIIFYEMLTGHIPYDGDSAVTIALQHFQKPLPSVIAENPSVPQALENVIIKATAKKLT
1nw1A           QTENFPENDQMLEFFLNYLREQGNTRENELYKKSEDLVQETL---PFVPVSHFFWGVWGLLQVELSPVGF
2oi8A2          SALHRALSFWSRLHVLSLELAGQFTGXGFD----------------------------------------
1mruA           DSVDARSDVYSLGCVLYEVLTGEPPFTGDSPVSVAYQHVREDPIPPSARHEGLSADLDAVVLKALAKNPE
1nd4A           GIAAPDSQRIAFYRLLDEFF--------------------------------------------------
1v30A           GKGKLKVEVYEVDKETFERINEIEIGTGYRLVEVSTKFGKAFLW--------------------------
1tklA           RYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEHASWLYNHHPAPGSREAK-LLEVTTKPR---------
1zylA1          EFDTAEIGLIEPLRAMRLVYYLAWLMWADPAFPKNFPWLTGE----------------------------
1yvpA1          KDELEIIHLIDEYRLVREHLLTIHLKSKEIWKSLTALLRNLGKMTADSVLAPASSEVSSVCERLTNEKLL
1k25A1          ----------------------------------------------------------------------
1djnA2          DANTSHRWIEFDSLV---LVTG------------------------------------------------
2peiA1          ----------------------------------------------------------------------
1zelA2          NAA-------------------------------------------------------------------
2ppqA1          TKGKALLEGYQLRFFLTRLYDWLTTPAGALVVKKDPLEYLRKL----RFHRTIANVAE------------
1b6cB           FESFKRADIYAMGLVFWEIARRCSIGGIHE----------------------------------------
1t4hA           KY-DESVDVYAFGXCXLEXATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEV-KEIIEGCIRQNKD
1ia8A           REFHAEPDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEK-KTYLNPWKKIDSAPLALLHK-------
1fo8A           TYPLLKADPSLWCVSAWNDN-GKEQMVDSS----------------------------------------
1usuB           GKVISLFDLKITVLIEGHVDSALPFEGSINVPEVAFDSEA------------------------------
1b49A           VVNMFRNDYAWQKYVLDKLVSDLNAGD-------------------------------------------
1gosA2          YTLDDTKPEGNYAAIMGFILAHKARKLARLTKEERLKKLCELYAKVLGSL--EALEPVHYEEKNWCEEQY
1zkeA1          ----------------------------------------------------------------------
1b0pA4          VGLGGRINMIMQTAFFK--LAGVLPFEKAVDLLKKHKAYGKKGEKIVKMNTDAVDQAVTSLQEFKYPDSW
1r4vA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           NRYRSVSEMYVDLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1nw1A           GFA-------------------------------------------------------------------
2oi8A2          ----------------------------------------------------------------------
1mruA           NRYQTAAEMRADL---------------------------------------------------------
1nd4A           ----------------------------------------------------------------------
1v30A           ----------------------------------------------------------------------
1tklA           ----------------------------------------------------------------------
1zylA1          ----------------------------------------------------------------------
1yvpA1          KK--------------------------------------------------------------------
1k25A1          ----------------------------------------------------------------------
1djnA2          ----------------------------------------------------------------------
2peiA1          ----------------------------------------------------------------------
1zelA2          ----------------------------------------------------------------------
2ppqA1          ----------------------------------------------------------------------
1b6cB           ----------------------------------------------------------------------
1t4hA           ERY-SIKDL-------------------------------------------------------------
1ia8A           ----------------------------------------------------------------------
1fo8A           ----------------------------------------------------------------------
1usuB           ----------------------------------------------------------------------
1b49A           ----------------------------------------------------------------------
1gosA2          SG--------------------------------------------------------------------
1zkeA1          ----------------------------------------------------------------------
1b0pA4          KD--------------------------------------------------------------------
1r4vA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTPATIAIPDVAGQTVAEAKATLKKANFEIGX
1nw1A           ----------------------------------------------------------------------
2oi8A2          ----------------------------------------------------------------------
1mruA           ----------------------------------------------------------------------
1nd4A           ----------------------------------------------------------------------
1v30A           ----------------------------------------------------------------------
1tklA           ----------------------------------------------------------------------
1zylA1          ----------------------------------------------------------------------
1yvpA1          ----------------------------------------------------------------------
1k25A1          ---------------------------------------TESSYAMPSIKDISPGELAEALRRNIVQPI-
1djnA2          ----------------------------------------------------------------------
2peiA1          ----------------------------------------------------------------------
1zelA2          ----------------------------------------------------------------------
2ppqA1          ----------------------------------------------------------------------
1b6cB           ----------------------------------------------------------------------
1t4hA           ----------------------------------------------------------------------
1ia8A           ----------------------------------------------------------------------
1fo8A           ----------------------------------------------------------------------
1usuB           ----------------------------------------------------------------------
1b49A           ----------------------------------------------------------------------
1gosA2          ----------------------------------------------------------------------
1zkeA1          ----------------------------------------------------------------------
1b0pA4          ----------------------------------------------------------------------
1r4vA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           XXXXXXXXXXXGRIIRTDPGAGTGRKEGTKINLVVSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1nw1A           ----------------------------------------------------------------------
2oi8A2          ----------------------------------------------------------------------
1mruA           ----------------------------------------------------------------------
1nd4A           ----------------------------------------------------------------------
1v30A           ----------------------------------------------------------------------
1tklA           ----------------------------------------------------------------------
1zylA1          ----------------------------------------------------------------------
1yvpA1          ----------------------------------------------------------------------
1k25A1          ------VVGTGTKIKETSVEEGTNLAPNQQVLLLSD----------------------------------
1djnA2          ----------------------------------------------------------------------
2peiA1          ----------------------------------------------------------------------
1zelA2          ----------------------------------------------------------------------
2ppqA1          ----------------------------------------------------------------------
1b6cB           ----------------------------------------------------------------------
1t4hA           ----------------------------------------------------------------------
1ia8A           ----------------------------------------------------------------------
1fo8A           ----------------------------------------------------------------------
1usuB           ----------------------------------------------------------------------
1b49A           ----------------------------------------------------------------------
1gosA2          ----------------------------------------------------------------------
1zkeA1          ----------------------------------------------------------------------
1b0pA4          ----------------------------------------------------------------------
1r4vA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1nw1A           ----------------------------------------------------------------------
2oi8A2          ----------------------------------------------------------------------
1mruA           ----------------------------------------------------------------------
1nd4A           ----------------------------------------------------------------------
1v30A           ----------------------------------------------------------------------
1tklA           ----------------------------------------------------------------------
1zylA1          ----------------------------------------------------------------------
1yvpA1          ----------------------------------------------------------------------
1k25A1          ----------------------------------------------------------------------
1djnA2          ----------------------------------------------------------------------
2peiA1          ----------------------------------------------------------------------
1zelA2          ----------------------------------------------------------------------
2ppqA1          ----------------------------------------------------------------------
1b6cB           ----------------------------------------------------------------------
1t4hA           ----------------------------------------------------------------------
1ia8A           ----------------------------------------------------------------------
1fo8A           ----------------------------------------------------------------------
1usuB           ----------------------------------------------------------------------
1b49A           ----------------------------------------------------------------------
1gosA2          ----------------------------------------------------------------------
1zkeA1          ----------------------------------------------------------------------
1b0pA4          ----------------------------------------------------------------------
1r4vA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1nw1A           ----------------------------------------------------------------------
2oi8A2          ----------------------------------------------------------------------
1mruA           ----------------------------------------------------------------------
1nd4A           ----------------------------------------------------------------------
1v30A           ----------------------------------------------------------------------
1tklA           ----------------------------------------------------------------------
1zylA1          ----------------------------------------------------------------------
1yvpA1          ----------------------------------------------------------------------
1k25A1          ----------------------------------------------------------------------
1djnA2          ----------------------------------------------------------------------
2peiA1          ----------------------------------------------------------------------
1zelA2          ----------------------------------------------------------------------
2ppqA1          ----------------------------------------------------------------------
1b6cB           ----------------------------------------------------------------------
1t4hA           ----------------------------------------------------------------------
1ia8A           ----------------------------------------------------------------------
1fo8A           ----------------------------------------------------------------------
1usuB           ----------------------------------------------------------------------
1b49A           ----------------------------------------------------------------------
1gosA2          ----------------------------------------------------------------------
1zkeA1          ----------------------------------------------------------------------
1b0pA4          ----------------------------------------------------------------------
1r4vA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1nw1A           -----------------------------------------------------
2oi8A2          -----------------------------------------------------
1mruA           -----------------------------------------------------
1nd4A           -----------------------------------------------------
1v30A           -----------------------------------------------------
1tklA           -----------------------------------------------------
1zylA1          -----------------------------------------------------
1yvpA1          -----------------------------------------------------
1k25A1          -----------------------------------------------------
1djnA2          -----------------------------------------------------
2peiA1          -----------------------------------------------------
1zelA2          -----------------------------------------------------
2ppqA1          -----------------------------------------------------
1b6cB           -----------------------------------------------------
1t4hA           -----------------------------------------------------
1ia8A           -----------------------------------------------------
1fo8A           -----------------------------------------------------
1usuB           -----------------------------------------------------
1b49A           -----------------------------------------------------
1gosA2          -----------------------------------------------------
1zkeA1          -----------------------------------------------------
1b0pA4          -----------------------------------------------------
1r4vA           -----------------------------------------------------