[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF55228.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1jysA.bssp"
#ERROR : Can't open dsspfile "1k3fA.bssp"
#ERROR : Can't open dsspfile "1a69A.bssp"
#ERROR : Can't open dsspfile "1nw4A.bssp"
#ERROR : Can't open dsspfile "1a9oA.bssp"
#ERROR : Can't open dsspfile "1t8rA.bssp"
#ERROR : Can't open dsspfile "1cb0A.bssp"
#ERROR : Can't open dsspfile "1ybfA.bssp"

## Summary of PDB Search
:230
    1e-42  40%  1jysA  [c.56.2.1] MTA/SAH NUCLEOSIDASE
    1e-33  17%  1k3fA  [c.56.2.1] URIDINE PHOSPHORYLASE
    6e-32  24%  1a69A  [c.56.2.1] PURINE NUCLEOSIDE PHOSPHORYLASE
    4e-30  15%  1nw4A  [c.56.2.1] URIDINE PHOSPHORYLASE, PUTATIVE
    2e-23  12%  1a9oA  [c.56.2.1] PURINE NUCLEOSIDE PHOSPHORYLASE
    2e-16  16%  1t8rA  [c.56.2.1] AMP NUCLEOSIDASE
    3e-12  16%  1cb0A  [c.56.2.1] PROTEIN (5'-DEOXY-5'-METHYLTHIOADENOSINE
    2e-10  17%  1ybfA  [c.56.2.1] AMP NUCLEOSIDASE
:230

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKIGIIAAMPEELAYLVQHLDNAQEQVVLGNTYHTGTIASHEVVLVESGIGKVMSAMSVAILADHFQVDA
1jysA           MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
1k3fA           -TLAIVPGDPDRVEKIAALMDKPVKLAHREFTTWRAELDGKPVIVCSTGIGGPSTSIAVEELA-QLGIRT
1a69A           ---------PLRAKYIAETLEDARENNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKK
1nw4A           ----LVVGDPGRVDKIKVVCDSYVDLAYNREKSVECHYKGQKFLCVSHGVGSAGCAVCFEELC-QNGAKV
1a9oA           -QVAVINKLTQAQTFDYSEIPNFPESTVPGGRLVFGILNGRACVMMQGRFHMYYPFWKVTFPVRLLGVET
1t8rA           --------------------SDLAWKKHQXPAWHLITADGQGITLVNIGVGPSNAKTICDHLAVLRP-DV
1cb0A           VKIGIIGGTG---LDDPEILEGRTEKYVPSDALILGKIKNVDCVLARHGRQHTIMPSKVNYQAKEEGCTH
1ybfA           --------------YLHVFAEHYGVPIV-GEHTSXPNASAEGVTLINFGXG----SANAATIXDLIHPKA


                         .         .         *         .         .         .         .:140
query           LINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFESDKTFVAQIQESLSQLDQNW
1jysA           IINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNA
1k3fA           FLRIGTTGAIQPHINVGDVLVTTA--SVRLDGASLHFAPLEFPAVA-----DFECTTALVEAAKSIGATT
1a69A           IIRVGSCGAVLPHVKLRDVVIGMG-ACTDSKVNRIRFKDHDFAAIA-----DFDMVRNAVDAAKALGIDA
1nw4A           IIRAGSCGSLPDLIKRGDICICNA--AVREDRVSHLLIHGDFPAVG-----DFDVYDTLNKCAQELNVPV
1a9oA           LVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRRFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQR
1t8rA           WLXIGHCGGLRESQAIGDYVLAHAYLRDDHVLDAVLPPDIPISIAEVQRALYDATKLVSGRPGEEVKQRL
1cb0A           VIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPCPKTREVLIETAKKLGLRC
1ybfA           VIFLGKCGGLKLENALGDYLLPIA-AIRGEGTS------NDYLPEEVPSLPSFSVLRAISSAIQNKGKDY


                         +         .         .         .         .         *         .:210
query           HFGLIATGDSFVAGNDKIEAIKSHFPEVLAVEMEGXXXXXXXXXLNLPVLVIRAMSDNANHEANIFFDEF
1jysA           VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQSF----DEF
1k3fA           HVGVTASSDTFYPGQERYDTYSGRVVRVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIP-NAET
1a69A           RVGNLFSADLFYSPDGEMFDVMEKY-GILGVEMEAAGIYGVAAEFGAKALTICTVSDHTAAERQTTFNDM
1nw4A           FNGISVSSDMYYPNKIIPSRLEDSKANAAVVEMELATLMVIGTLRKVKTGGILIVDGCPFKWDEGDFDNN
1a9oA           ELGTYVMLGGPN-FETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVISQGKANHEEV
1t8rA           RTGTVVTTDDRNWERYSASALRFNLSRAVAIDXESATIAAQGYRFRVPYGTLLCVSDKPLHGEIKLPGQA
1cb0A           HSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWAVSV---DR
1ybfA           WTGTVYTTNRRVWEYDEKFKDYLRSTHASGVDXETATLXTVGFANKIPXGALLLISDRPXF---------


                         .         .         .         +         .         .         .:280
query           IIEAGRRSAQVLLTFLKALD
1jysA           LAVAAKQSSLMVESLVQKL-
1k3fA           MKQTESHAVKIVVEAARRL-
1a69A           I-------------------
1nw4A           MIKIALGACAKLAT------
1a9oA           LKQAAQKLEQFVSLLMASIP
1t8rA           NEGAISEHLQIGIRAIDLL-
1cb0A           VLKTLKENANKAKSLLLTT-
1ybfA           --------------------