[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF55245.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1uddA.bssp"
#ERROR : Can't open dsspfile "1z72A1.bssp"
#ERROR : Can't open dsspfile "1rtwA.bssp"
#ERROR : Can't open dsspfile "1to9A.bssp"
#ERROR : Can't open dsspfile "2f2gA1.bssp"
#ERROR : Can't open dsspfile "1wwmA1.bssp"
#ERROR : Can't open dsspfile "1otvA.bssp"
#ERROR : Can't open dsspfile "1rcwA.bssp"
#ERROR : Can't open dsspfile "2a2mA1.bssp"

## Summary of PDB Search
:230
    4e-51  24%  1uddA  [a.132.1.3] TRANSCRIPTIONAL REGULATOR
    1e-47  23%  1z72A1 [a.132.1.3] TRANSCRIPTIONAL REGULATOR, PUTATIVE A:4 -- 220
    2e-41  19%  1rtwA  [a.132.1.3] TRANSCRIPTIONAL ACTIVATOR, PUTATIVE
    9e-40  34%  1to9A  [a.132.1.3] THI-4 PROTEIN
    3e-38  11%  2f2gA1 [a.132.1.3] SEED MATURATION PROTEIN PM36 HOMOLOG A:5 -- 219
    7e-35  14%  1wwmA1 [a.132.1.3] HYPOTHETICAL PROTEIN TT2028 A:11 -- 190
    9e-29  12%  1otvA  [a.132.1.4] COENZYME PQQ SYNTHESIS PROTEIN C
    1e-23  21%  1rcwA  [a.132.1.4] CT610
    3e-21  20%  2a2mA1 [a.132.1.3] HYPOTHETICAL PROTEIN BT3146 A:10 -- 240
:230

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEFTDIAMELSKKAWQASFHHPFILQLQEGNLEPAIFRYYLIQDAYYLKAFSEIYHLLADKTSNQEMKRL
1uddA           VMITDKLRRDSEQIWKKIFEHPFVVQLYSGTLPLEKFKFYVLQDFNYLVGLTRALAVISSKAEYPLMAEL
1z72A1          --TVGELLKSSQKDWQAAINHRFVKELFAGTIENKVLKDYLIQDYHFFDAFLSXLGACVAHADKLESKLR
1rtwA           --FSEELIKENENIWRRFLPHKFLIEXAENTIKKENFEKWLVNDYYFVKNALRFXALLXAKAPDDLLPFF
1to9A           -KFSEECRSAAAEWWEGSFVHPFVQGIGDGTLPIDRFKYYVLQDSYYLTHFAKVQSFGAAYAKDLYTTGR
2f2gA1          --VIDTWIDKHRSIYTAATRHAFVVSIRDGSVDLSSFRTWLGQDYLFVRRFVPFVASVLIRACKDSGESS
1wwmA1          -----------PGLLEEIKALPLRL-------DEERFRFWLQQDYPFVEALYRYQVGLLLEAPQAHRAPL
1otvA           LSPQAFEEALRAKGDFYHIHHPYHIAMHNGDATRKQIQGWVANRFYYQTTIPLKDAAIMANCPDAQTRRK
1rcwA           -------------QNKHXLEHTFYVKWSKGELTKEQLQAYAKDYYLHIKAFPKYLSAIHSRCDDLEARKL
2a2mA1          ---------------VQVLQTDYFKGIAAGTLDPNAYGSLXVQDGYYCFRGRDDYATAATCAQDETLREF


                         .         .         *         .         .         .         .:140
query           LKQNAQGLVEGELFIRQQFFKELEISDQEMEQHPIAPTCYHYISHIYRQFAEPNLAIAFASLLPCPWLYH
1uddA           I-ELARDEVTVEVENYVKLLKELDLTLEDAIKTEPTLVNSAYMDFMLATAYKGNIIEGLTALLPCFWSYA
1z72A1          FAKQLGFLEADEDGYFQKAFKELKVAENDYLEVTLHPVTKAFQDLXYSAVASSDYAHLLVXLVIAEGLYL
1rtwA           AESIYY--ISKELEXFEKKAQELGIS----LNGEIDWRAKSYVNYLLSVASLGSFLEGFTALYCEEKAYY
1to9A           XASHAQGTYEAEXALHREFAELLEISEEERKAFKPSPTAYSYTSHXYRSVLSGNFAEILAALLPCYWLYY
2f2gA1          DXEVVLGGLNDEIEWFKREGSKWDV---DFSTVVPQRANQEYGRFLEDLXSSEVYPVIXTAFWAIEAVYQ
1wwmA1          VQALXATVEELDWLLLQ----------GASPSAPVHPVRAGYIALLEEXGRLPYAYRVVF-FYFLNGLFL
1otvA           WVQRGSHGEDGGIEAWLRLGEAVGLSRDDLLSEHVLPGVRFAVDAYLNFARRACWQEAACSSLTELFAPQ
1rcwA           LLDNEENGYPNHIDLWKQFVFALGVTPEELEAHEPSEAAKAKVATFXRWCTGDSLAAGVAALYSYESQIP
2a2mA1          FKAKAKSYDEYNETYHQTWHLR------EASGLIPGTDIKDYADYEAYVAGSLASPYXCVVXLPCEYLWP


                         +         .         .         .         .         *         .:210
query           DIGKSLNLKPSPNPLYQQWIETYITDELEQQIREEGALVNQLYRESDETDKQKMLDAFHISVHMEAKFWE
1uddA           EIAEKDKLRDNPIKIYREWGKVYLSNEYLNLVGR----LRKIIDSSGHSGYDRLRRIFITGSKFELAFWE
1z72A1          DWGSKDLALPEVYI-HSEWINLHRGPFFAEWVQF---LVDELNRVGKREDLTELQQRWNQAVALELAFFD
1rtwA           EAWKWVRENLKERSPYQEFINHWSSQEFGEYVKRIEKILNSLAEKHGEFEKERAREVFKEVSKFELIFWD
1to9A           EVGEKLLHCDPGHPIYQKWIGTYGGDWFRQQVEEQINRFDELAENSTEEVRAKXKENFVISSYYEYQFWG
2f2gA1          ESFAHCLEDGNKTPELTGACHRWGNDGFKQYCSSVKNIAERCLENASGEVLGEAEDVLVRVLELEVAFWE
1wwmA1          EAWAHH---VPEEGPWAELSQHWFAPEFQAVLYDLEVLARGL---WEDLDPEVVRTYLRRILEAEKATWS
1otvA           IHQSRLDSWPQHYPWIKEEGYFYFRSRLSQANRDVEHGLALAKACDSAEKQNRMLEILQFKLDILWSMLD
1rcwA           RIAREKEYFGFSNPDYAYFTEHEEADVRH--AREEKALIEXLLKD----DADKVLEASQEVTQSLYGFLD
2a2mA1          WIANFLDGYTPTNSLYRFWIEWNGTPNGAYQXG------NXLEQYRDKIDEDKAVEIFNTAXNYELKVF-


                         .         .         .         +         .         .         .:280
query           MAYQHQTWKxxxxxxxxxxx
1uddA           MAWRG---------------
1z72A1          IGY-----------------
1rtwA           IAY-----------------
1to9A           XAYRKEGWS-----------
2f2gA1          XSR-----------------
1wwmA1          LL------------------
1otvA           AMT-----------------
1rcwA           --------------------
2a2mA1          --------------------