[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF55303.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1wljA.bssp"
#ERROR : Can't open dsspfile "1j53A.bssp"
#ERROR : Can't open dsspfile "1j9aA.bssp"
#ERROR : Can't open dsspfile "2f96A1.bssp"
#ERROR : Can't open dsspfile "1vk0A.bssp"
#ERROR : Can't open dsspfile "1q8iA1.bssp"
#ERROR : Can't open dsspfile "1tp6A.bssp"
#ERROR : Can't open dsspfile "1y97A1.bssp"
#ERROR : Can't open dsspfile "1d8yA1.bssp"
#ERROR : Can't open dsspfile "2hbjA2.bssp"
#ERROR : Can't open dsspfile "1fxxA.bssp"
#ERROR : Can't open dsspfile "1skrA1.bssp"
#ERROR : Can't open dsspfile "1a1vA1.bssp"
#ERROR : Can't open dsspfile "1m6nA3.bssp"
#ERROR : Can't open dsspfile "1yt3A3.bssp"
#ERROR : Can't open dsspfile "1w0hA.bssp"
#ERROR : Can't open dsspfile "1l3sA1.bssp"
#ERROR : Can't open dsspfile "1pjrA1.bssp"
#ERROR : Can't open dsspfile "1qhh.1.bssp"
#ERROR : Can't open dsspfile "2fwrA2.bssp"
#ERROR : Can't open dsspfile "1gm5A3.bssp"
#ERROR : Can't open dsspfile "1iibA.bssp"
#ERROR : Can't open dsspfile "1hv8A1.bssp"
#ERROR : Can't open dsspfile "1yksA1.bssp"
#ERROR : Can't open dsspfile "1gkuB1.bssp"
#ERROR : Can't open dsspfile "1ygyA2.bssp"
#ERROR : Can't open dsspfile "2eyqA3.bssp"
#ERROR : Can't open dsspfile "1gkuB2.bssp"

## Summary of PDB Search
:816
    5e-23  20%  1wljA  [c.55.3.5] INTERFERON STIMULATED GENE 20KDA
    6e-23  24%  1j53A  [c.55.3.5] DNA POLYMERASE III, EPSILON CHAIN
    6e-21  14%  1j9aA  [c.55.3.5] OLIGORIBONUCLEASE
    1e-19  28%  2f96A1 [c.55.3.5] RIBONUCLEASE T A:19 -- 220
    5e-15  11%  1vk0A  [c.55.3.5] HYPOTHETICAL PROTEIN
    9e-15  18%  1q8iA1 [c.55.3.5] DNA POLYMERASE II A:2 -- 389
    3e-14  13%  1tp6A  [d.17.4.12] HYPOTHETICAL PROTEIN PA1314
    5e-14  28%  1y97A1 [c.55.3.5] THREE PRIME REPAIR EXONUCLEASE 2 A:1 -- 228
    1e-09  19%  1d8yA1 [c.55.3.5] DNA POLYMERASE I A:324 -- 518
    1e-09  13%  2hbjA2 [c.55.3.5] EXOSOME COMPLEX EXONUCLEASE RRP6 A:129 -- 420
    2e-09  17%  1fxxA  [c.55.3.5] EXONUCLEASE I
    1e-08  13%  1skrA1 [c.55.3.5] DNA POLYMERASE A:1 -- 210
    2e-07  11%  1a1vA1 [c.37.1.14] PROTEIN (NS3 PROTEIN) A:190 -- 325
    6e-07  20%  1m6nA3 [c.37.1.19] PREPROTEIN TRANSLOCASE SECA A:1 -- 226 A:349 --
    1e-06  18%  1yt3A3 [c.55.3.5] RIBONUCLEASE D A:1 -- 193
    2e-06  17%  1w0hA  [c.55.3.5] 3'-5' EXONUCLEASE ERI1
    2e-06  17%  1l3sA1 [c.55.3.5] DNA POLYMERASE I A:297 -- 468
    4e-06  14%  1pjrA1 [c.37.1.19] PCRA A:1 -- 318
    1e-05  22%  1qhh.1 [c.37.1.19] PROTEIN (PCRA (SUBUNIT)) A:- -- - B:- -- - C:-
    1e-05  25%  2fwrA2 [c.37.1.19] DNA REPAIR PROTEIN RAD25 A:23 -- 256
    2e-05  38%  1gm5A3 [c.37.1.19] RECG A:286 -- 549
    3e-05  12%  1iibA  [c.44.2.1] ENZYME IIB OF THE CELLOBIOSE-SPECIFIC
    4e-05  19%  1hv8A1 [c.37.1.19] PUTATIVE ATP-DEPENDENT RNA HELICASE MJ0669 A:3
    5e-05  14%  1yksA1 [c.37.1.14] GENOME POLYPROTEIN [CONTAINS: FLAVIVIRIN A:185
    9e-05  28%  1gkuB1 [c.37.1.16] REVERSE GYRASE B:1 -- 250
    1e-04  19%  1ygyA2 [c.23.12.1] D-3-PHOSPHOGLYCERATE DEHYDROGENASE A:3 -- 98
    4e-04  19%  2eyqA3 [c.37.1.19] TRANSCRIPTION-REPAIR COUPLING FACTOR A:546 --
    4e-04  11%  1gkuB2 [c.37.1.16] REVERSE GYRASE B:251 -- 498
:816

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxGNRYVVVDLEATSTGSKAKXXXXXXXXXXXXXXXXHYTTDVNPHEPLDAHIKELTGLTDQRLAQAP
1wljA           -------VVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKF-IRPEGEITDYRTRVSGVTPQHMVGAT
1j53A           ------RQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNFHVYLKPDRLVDPEAFGVHGIADEFLLDKP
1j9aA           -----QNLIWIDLEXTGLDPEKERIIEIATIVTDKNLNILSDELLNKXNDWCQKTHSENGLIERIKASKL
2f96A1          ----GYLPVVVDVE--TGGFNSATDALLEIAATTVGXDEKYFFRIEPFENIEPAALEFTGIKDHPLRXAV
1vk0A           ------TKTIDVGSSTDILSLIREDSILNGNRAVIFDVYWDVGFTKTSGWSLSSVKLSTRNLCLFLRLPK
1q8iA1          ------KWVSIDIETTRHGELY-------CIGLEGCGQRIVYMLGPENGDASSLDFELEYVAS-----RP
1tp6A           ----------------------------------------------------------------------
1y97A1          ----------------------------------------LTLCXCPERPFTAKASEITGLSSEGLARCR
1d8yA1          ------------------------------------------------------IPVAHDYLDAPDQISR
2hbjA2          -----------------------------------------HHDYRSYYGIVCLMQ-ISTRERDYLVDTL
1fxxA           -----STFLFHDYETFGTHPALDRPAQFAAIRTDSEFNVVFYCKPADDYLPQPGAVLITGITPQEARAKA
1skrA1          -------------------------------------------------------------AEYVSYRPS
1a1vA1          ----------------------------------------------------------------------
1m6nA3          ----------------------------------------------------------------------
1yt3A3          ----------------------------------------------------------------------
1w0hA           -----DYICIIDFEATCEEGNPPEFVHEIIEFPVVLLNTHFQQYVRPNTQLSDFCISLTGITQDQVDRAD
1l3sA1          ----------------------------------------------------------------------
1pjrA1          ----------------------------------------------------------------------
1qhh.1          ----------------------------------------------------------------------
2fwrA2          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------
1iibA           ----------------------------------------------------------------------
1hv8A1          ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1gkuB1          ----------------------------------------------------------------------
1ygyA2          ---------------------------------------------------PSTVAALGDQVEVRWVDGP
2eyqA3          ----------------------------------------------------------------------
1gkuB2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DFSQVARKIFDLVEDGIFVAHNVQFDANLLAENLFFEGYELRNPRVDTVELAQVFFPELEKYSLPILCRE
1wljA           PFAVARLEILQLLKGKLVVGHDLKHDFQAL--KEDMSGYTIYDTSTDRLLWREAKLVSLRVLSERLLHKS
1j53A           TFAEVADEFMDYIRGAELVIHNAAFDIGFMDYKRDIPKTNTFCKVTDSLAVARKMFP-GKRNSLDALCAR
1j9aA           TERAAELQTLDFLKKWPICGNSIAQDKRFLVKYXPDLADYFHYRHLDVSTLKELAARWKPEI-------L
2f96A1          QEEAALTEIFRGIKRAILVGHNSSFDLGFLNAAVARTGIK-RNPFFDTATLAGLAYGQ---TVLAKACQA
1vk0A           PFHDNLKDLYRFFASKTFVGVQIEED--LDLLRENHGLVIRNAINVGKLAAEARGTLVLEFLGTRELAHR
1q8iA1          QLLEKLNAWFANYDPDVIIGWNVVFDLRMLQKHAERYRLPLRLGRIDGIEALKSAFWNFSSFSLETVAQE
1tp6A           ---------------------------------------AYRREIHHAHVAIRDWLADSRADALDALMAR
1y97A1          KAGAVVRTLQAFLSPICLVAHNFDYDFPLLCAELRRLGARLDTVCLDTLPALR-GLDRAHGYSLGSLFHR
1d8yA1          ERALELLKPLLEDEKALKVGQNLKYDRG----ILANYGIELRGIAFDTMLESYILNSVAGRHDMDSLAER
2hbjA2          KLRENLHILNEVFTNPVKVFHGAFMDIIWLQRDLGLYVKAIGLPRHSLAYLLENFANKTSKKYQLADWRI
1fxxA           AFAARIHSLFTVPKTCILGYNNVRFDDEVTRNIFYAWSWQHDNSRWDLLDVGINWPEGLPSFRLEHLTKA
1skrA1          DFGAYLDALEAEVARGIVFHNGHKYDVPALTKLANREFHLPRENCIDTLVLSRLIHSNLKDTDMGLLRSG
1a1vA1          ----------------------------------------------------------------------
1m6nA3          ----------------------------------------------------------------------
1yt3A3          -------------PSITKFLHAGSEDLEVFLN----VFGELPQPLIDTQILAAFCGRPMSWGFASMVEEY
1w0hA           TFPQVLKKVLGTKYKYSLLTDGSWDXSKFLNIQCQLSRLKYPKKWINIRKSYGNFYKVPSQTKLTIXLEK
1l3sA1          -------------ETKKKSMFDSKRAAVALKW----KGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKM
1pjrA1          ----------------------------------------------------------------------
1qhh.1          ----------------------------------------------------------------------
2fwrA2          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------
1iibA           ----------------------------------------------------------------------
1hv8A1          ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1gkuB1          ----------------------------------------------------------------------
1ygyA2          DRDKLLAAVPEA--DALLVRSATTVDAEVLAAAPKLKIVARAGVGLDNVDVD--------------AATA
2eyqA3          ----------------------------------------------------------------------
1gkuB2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LGIPLKHAHTALSDAQATAELLLFLREKMTQLPKGLLERLLEMADALLYESYLVIEETYRNQSILxxxxx
1wljA           IQNSL-LGHSSVEDARATMELYQISQR---IRARRGLPRL------------------------------
1j53A           YEIDNSKLHGALLDAQILAEVYLAM---------------------------------------------
1j9aA           EGFKKENTHLALDDIRESIKELAYYREHFXKL--------------------------------------
2f96A1          AGXEFREAHSARYDTEKTAELFCGIVNRW-----------------------------------------
1vk0A           VAGPEEQLEAAAIEGWLIVNVWDQLSDE------------------------------------------
1q8iA1          LLMDEIDRRFAEDKPALACELVTQIFHKTE-----IMPFLLERATVNGLPVDRHGGSVAAFGHLY-----
1tp6A           FAEDFVTPHGVVLDKTALGELFRSKGGTRPGLRIEIDGESLLASGV------------------------
1y97A1          YF--RAEPSSAEGDVHTL--LLIFLHR---------AAELLAWADEQA-RGWAHIEPXY-----------
1d8yA1          WLKLEEAGRYAAEDADVTLQLHLKMWPDLQK---------------------------------------
2hbjA2          RPLSKPMTAAARADTHFLLNIYDQLRNKLIESNKLAGVLYESR---------------------------
1fxxA           NGIEHSNAHDAMADVYATIAMAKLVKTRQPR---------------------------------------
1skrA1          KLPGAAWGYRLGEMKGEYKDDFKRMLEEQGEEYVDGMEWWNFNEEMMDY---------------------
1a1vA1          ----------------------------------------------------------------------
1m6nA3          ----------------------------------------------------------------------
1yt3A3          SGVTLDKCEYAAADVWYLLPITAKLMVETEA--SGWLPAALD----------------------------
1w0hA           LGXDYDRPHCGLDDSKNIARIAV-----------------------------------------------
1l3sA1          KQYEPVLAEHLVRKAAAIWELERPFLDEL-----------------------------------------
1pjrA1          ----------------------------------------------------------------------
1qhh.1          ----------------------------------------------------------------------
2fwrA2          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------
1iibA           ----------------------------------------------------------------------
1hv8A1          ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1gkuB1          ----------------------------------------------------------------------
1ygyA2          RGVLVVNAPTSAST--AEAQDRAGT---------------------------------------------
2eyqA3          ----------------------------------------------------------------------
1gkuB2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxLYFKKTAASLELRKLSQDFSKNISLLNLEVREEQESFAKEVGLLLKDEPVSLIQAPTGIGKTYGY
1wljA           ----------------------------------------------------------------------
1j53A           ----------------------------------------------------------------------
1j9aA           ----------------------------------------------------------------------
2f96A1          ----------------------------------------------------------------------
1vk0A           ----------------------------------------------------------------------
1q8iA1          ----------------------------------------------------------------------
1tp6A           ----------------------------------------------------------------------
1y97A1          ----------------------------------------------------------------------
1d8yA1          ----------------------------------------------------------------------
2hbjA2          ----------------------------------------------------------------------
1fxxA           ----------------------------------------------------------------------
1skrA1          ----------------------------------------------------------------------
1a1vA1          --------------------------------------------------------HLHAPTGSGKSTKV
1m6nA3          --------------------------------------------------------IAEMKTGEGKTLTS
1yt3A3          ----------------------------------------------------------------------
1w0hA           ----------------------------------------------------------------------
1l3sA1          ----------------------------------------------------------------------
1pjrA1          --------------------------------------------------------LIMAGAGSGKTRVL
1qhh.1          --------------------------------------------------------LIMAGAGSGKTRVL
2fwrA2          -------------------------------EISLRDYQE---KALERWLVDKRG-CIVLPTGSGKTHVA
1gm5A3          --------------------------------------------------------LLQGDVGSGKTVVA
1iibA           --------------------------------------------------------QNADVVLLGPQIAY
1hv8A1          ------------------------------------------------FLNDEYNIVAQARTGSGKTASF
1yksA1          -----------------------------------------------MLKKGMTT-VLDFHPGAGKTRRF
1gkuB1          ------------------------------------------------ILRKESF-AATAPTGVGKTSFG
1ygyA2          ----------------------------------------------------------------------
2eyqA3          -----IYAQRAAKEFAFKHDREQYQLFCDSFPFETTPDQAQAINAVLSDMCQPLAMLVCGDVGFGKTEVA
1gkuB2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LLPALSQSKERQIVLSVPTKILQNQIMEEEGKRLKEVFHTDIHSLKGPQNYLKLDAFYHSLQENDENRLF
1wljA           ----------------------------------------------------------------------
1j53A           ----------------------------------------------------------------------
1j9aA           ----------------------------------------------------------------------
2f96A1          ----------------------------------------------------------------------
1vk0A           ----------------------------------------------------------------------
1q8iA1          ----------------------------------------------------------------------
1tp6A           ----------------------------------------------------------------------
1y97A1          ----------------------------------------------------------------------
1d8yA1          ----------------------------------------------------------------------
2hbjA2          ----------------------------------------------------------------------
1fxxA           ----------------------------------------------------------------------
1skrA1          ----------------------------------------------------------------------
1a1vA1          PAAYAAQGYKVLVL--NPSVAATLGFGAYMSKAHGVNIRTGVRTITTGSPITYSTYGKFLADGGXSGGAY
1m6nA3          TLPVYLNALTKGVHVVTVNEYLASRDAEQMGKIFEFLGLTAADITYSTNNELGFDYLRDNMVLYKEQMVQ
1yt3A3          ----------------------------------------------------------------------
1w0hA           ----------------------------------------------------------------------
1l3sA1          ----------------------------------------------------------------------
1pjrA1          THRIAKHVAPWNILAITFTNKAAREMRERVQSLLG---GAAEDVWISTFHSMCVRILRRDIDRIGINRNF
1qhh.1          THRIAKHVAPWNILAITFTNKAAREMRERVQSLLGG----------------------------------
2fwrA2          --MAAINELSTPTLIVVPTLALAEQWKERLGIFGEEYVGEFSGRIKELKPL--TVSTYDSAYVNAE-KLG
1gm5A3          QLAILNYEAGFQTAFMVPTSILAIQHY----RRTVESF--------------------------------
1iibA           MLPEIQRLLPNKPVEVIDSLLYGKVDGLG-----------------------------------------
1hv8A1          AIPLIELVNENEAIILTPTRELAIQVADEIESLKGNKNL-------------KIAKIYGGKAIYPQIKAL
1yksA1          LPQILAECARRRTLVLAPTRVVLSEMKEAFHGLDVKFHTQAFSAHGSGREVIDAMCHATLTYRMLEPTRV
1gkuB1          LAMSLFLALKGKRCYVIPTSLLVIQAAETIRKYAEKAGV-------------------------------
1ygyA2          ----------------------------------------------------------------------
2eyqA3          MRAALAVDNHKQVAVLVPTTLLAQQHYDNFRDRFAN----------------------------------
1gkuB2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           RRFKMQVLVWLTETETGDLDEIGQLYRYQHFLADLRHDGNLSSHSLFVTEDFWKRSQERAETCKLLVTNH
1wljA           ----------------------------------------------------------------------
1j53A           ----------------------------------------------------------------------
1j9aA           ----------------------------------------------------------------------
2f96A1          ----------------------------------------------------------------------
1vk0A           ----------------------------------------------------------------------
1q8iA1          ----------------------------------------------------------------------
1tp6A           ----------------------------------------------------------------------
1y97A1          ----------------------------------------------------------------------
1d8yA1          ----------------------------------------------------------------------
2hbjA2          ----------------------------------------------------------------------
1fxxA           ----------------------------------------------------------------------
1skrA1          ----------------------------------------------------------------------
1a1vA1          DIIICDECHSTDA---------------------------------------------------------
1m6nA3          RPLHFAVI--------------------------------------------------------------
1yt3A3          ----------------------------------------------------------------------
1w0hA           ----------------------------------------------------------------------
1l3sA1          ----------------------------------------------------------------------
1pjrA1          SSVMKTILKEKNIDPKKFEPRTILGTISAAKNELLPPEQFAKRYYEKVVSDVYQEYQQRLLRNHSLDFDD
1qhh.1          ----------------------------------------------------------------------
2fwrA2          NRFMLLIFDEVHHLPAESYVQIAQMSIAPFRLG-------------------------------------
1gm5A3          ----------------------------------------------------------------------
1iibA           ----------------------------------------------------------------------
1hv8A1          KNANIVV---GTPGRILDHINRGTLNKNVKYFILDEADEXLNXGFIKDVEKILNACNKDKRILLFSATXP
1yksA1          VNWE---VIIMDE---------------------------------------------------------
1gkuB1          ----------------------------------------------------------------------
1ygyA2          ----------------------------------------------------------------------
2eyqA3          ----------------------------------------------------------------------
1gkuB2          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           AYLVTRLEDNPEFVSDRLLIIDEVQKILLALENLLQETYDIQSIIDLIDKALVGEENRVQQRILESIRFE
1wljA           ----------------------------------------------------------------------
1j53A           ----------------------------------------------------------------------
1j9aA           ----------------------------------------------------------------------
2f96A1          ----------------------------------------------------------------------
1vk0A           ----------------------------------------------------------------------
1q8iA1          ----------------------------------------------------------------------
1tp6A           ----------------------------------------------------------------------
1y97A1          ----------------------------------------------------------------------
1d8yA1          ----------------------------------------------------------------------
2hbjA2          ----------------------------------------------------------------------
1fxxA           ----------------------------------------------------------------------
1skrA1          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1m6nA3          ----------------------------------------------------------------------
1yt3A3          ----------------------------------------------------------------------
1w0hA           ----------------------------------------------------------------------
1l3sA1          ----------------------------------------------------------------------
1pjrA1          LIMTT----IQLFDRVPDVLHYYQYKFQYIHIDEYQDTNRAQYTL------VKKLAERFQNICAVGDADQ
1qhh.1          ----------------------------------------------------------------------
2fwrA2          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------
1iibA           ----------------------------------------------------------------------
1hv8A1          RELAKKYXGDYSFIK-------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1gkuB1          ----------------------------------------------------------------------
1ygyA2          ----------------------------------------------------------------------
2eyqA3          ----------------------------------------------------------------------
1gkuB2          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           CLYLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1wljA           ----------------------------------------------------------------------
1j53A           ----------------------------------------------------------------------
1j9aA           ----------------------------------------------------------------------
2f96A1          ----------------------------------------------------------------------
1vk0A           ----------------------------------------------------------------------
1q8iA1          ----------------------------------------------------------------------
1tp6A           ----------------------------------------------------------------------
1y97A1          ----------------------------------------------------------------------
1d8yA1          ----------------------------------------------------------------------
2hbjA2          ----------------------------------------------------------------------
1fxxA           ----------------------------------------------------------------------
1skrA1          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1m6nA3          ----------------------------------------------------------------------
1yt3A3          ----------------------------------------------------------------------
1w0hA           ----------------------------------------------------------------------
1l3sA1          ----------------------------------------------------------------------
1pjrA1          SIYR------------------------------------------------------------------
1qhh.1          ----------------------------------------------------------------------
2fwrA2          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------
1iibA           ----------------------------------------------------------------------
1hv8A1          ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1gkuB1          ----------------------------------------------------------------------
1ygyA2          ----------------------------------------------------------------------
2eyqA3          ----------------------------------------------------------------------
1gkuB2          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1wljA           ----------------------------------------------------------------------
1j53A           ----------------------------------------------------------------------
1j9aA           ----------------------------------------------------------------------
2f96A1          ----------------------------------------------------------------------
1vk0A           ----------------------------------------------------------------------
1q8iA1          ----------------------------------------------------------------------
1tp6A           ----------------------------------------------------------------------
1y97A1          ----------------------------------------------------------------------
1d8yA1          ----------------------------------------------------------------------
2hbjA2          ----------------------------------------------------------------------
1fxxA           ----------------------------------------------------------------------
1skrA1          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1m6nA3          ----------------------------------------------------------------------
1yt3A3          ----------------------------------------------------------------------
1w0hA           ----------------------------------------------------------------------
1l3sA1          ----------------------------------------------------------------------
1pjrA1          ----------------------------------------------------------------------
1qhh.1          ----------------------------------------------------------------------
2fwrA2          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------
1iibA           ----------------------------------------------------------------------
1hv8A1          ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1gkuB1          ----------------------------------------------------------------------
1ygyA2          ----------------------------------------------------------------------
2eyqA3          ----------------------------------------------------------------------
1gkuB2          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxVAALLVEIQAFQQPILVLFTAKDMLLAVSDLLTVSHLAQYKNGDVHQLKKRFEKGEQQILLGAASFWE
1wljA           ----------------------------------------------------------------------
1j53A           ----------------------------------------------------------------------
1j9aA           ----------------------------------------------------------------------
2f96A1          ----------------------------------------------------------------------
1vk0A           ----------------------------------------------------------------------
1q8iA1          ----------------------------------------------------------------------
1tp6A           ----------------------------------------------------------------------
1y97A1          ----------------------------------------------------------------------
1d8yA1          ----------------------------------------------------------------------
2hbjA2          ----------------------------------------------------------------------
1fxxA           ----------------------------------------------------------------------
1skrA1          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1m6nA3          ----------------------------------------------------------------------
1yt3A3          ----------------------------------------------------------------------
1w0hA           ----------------------------------------------------------------------
1l3sA1          ----------------------------------------------------------------------
1pjrA1          ----------------------------------------------------------------------
1qhh.1          ----------------------------------------------------------------------
2fwrA2          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------
1iibA           ----------------------------------------------------------------------
1hv8A1          ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1gkuB1          ----------------------------------------------------------------------
1ygyA2          ----------------------------------------------------------------------
2eyqA3          ----------------------------------------------------------------------
1gkuB2          --ISTLSSILEKLGTGGIIYARTGEEAEEIYESLKNKFRIGIVTATKKGDYEKFVEGEIDHLIGTAHRGL


                         .         .         .         .         +         .         .:770
query           GVDFSSHPFVIQVVPRLPFQNPQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1wljA           ----------------------------------------------------------------------
1j53A           ----------------------------------------------------------------------
1j9aA           ----------------------------------------------------------------------
2f96A1          ----------------------------------------------------------------------
1vk0A           ----------------------------------------------------------------------
1q8iA1          ----------------------------------------------------------------------
1tp6A           ----------------------------------------------------------------------
1y97A1          ----------------------------------------------------------------------
1d8yA1          ----------------------------------------------------------------------
2hbjA2          ----------------------------------------------------------------------
1fxxA           ----------------------------------------------------------------------
1skrA1          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1m6nA3          ----------------------------------------------------------------------
1yt3A3          ----------------------------------------------------------------------
1w0hA           ----------------------------------------------------------------------
1l3sA1          ----------------------------------------------------------------------
1pjrA1          ----------------------------------------------------------------------
1qhh.1          ----------------------------------------------------------------------
2fwrA2          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------
1iibA           ----------------------------------------------------------------------
1hv8A1          ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1gkuB1          ----------------------------------------------------------------------
1ygyA2          ----------------------------------------------------------------------
2eyqA3          ----------------------------------------------------------------------
1gkuB2          DLPERIRFAVFVGCPSFRVTIED-----------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1wljA           ----------------------------------------------
1j53A           ----------------------------------------------
1j9aA           ----------------------------------------------
2f96A1          ----------------------------------------------
1vk0A           ----------------------------------------------
1q8iA1          ----------------------------------------------
1tp6A           ----------------------------------------------
1y97A1          ----------------------------------------------
1d8yA1          ----------------------------------------------
2hbjA2          ----------------------------------------------
1fxxA           ----------------------------------------------
1skrA1          ----------------------------------------------
1a1vA1          ----------------------------------------------
1m6nA3          ----------------------------------------------
1yt3A3          ----------------------------------------------
1w0hA           ----------------------------------------------
1l3sA1          ----------------------------------------------
1pjrA1          ----------------------------------------------
1qhh.1          ----------------------------------------------
2fwrA2          ----------------------------------------------
1gm5A3          ----------------------------------------------
1iibA           ----------------------------------------------
1hv8A1          ----------------------------------------------
1yksA1          ----------------------------------------------
1gkuB1          ----------------------------------------------
1ygyA2          ----------------------------------------------
2eyqA3          ----------------------------------------------
1gkuB2          ----------------------------------------------