[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF55326.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ecsA.bssp"
#ERROR : Can't open dsspfile "1f1rA1.bssp"
#ERROR : Can't open dsspfile "1bylA.bssp"
#ERROR : Can't open dsspfile "1mpyA1.bssp"
#ERROR : Can't open dsspfile "1r9cA.bssp"
#ERROR : Can't open dsspfile "2pjsA1.bssp"
#ERROR : Can't open dsspfile "1xqaA.bssp"
#ERROR : Can't open dsspfile "1kllA.bssp"
#ERROR : Can't open dsspfile "1jc4A.bssp"
#ERROR : Can't open dsspfile "1dhyA2.bssp"
#ERROR : Can't open dsspfile "1twuA.bssp"
#ERROR : Can't open dsspfile "1zswA1.bssp"
#ERROR : Can't open dsspfile "1cjxA1.bssp"
#ERROR : Can't open dsspfile "1f9zA.bssp"
#ERROR : Can't open dsspfile "1sp9A.bssp"
#ERROR : Can't open dsspfile "1f1rA2.bssp"
#ERROR : Can't open dsspfile "1bh5A.bssp"
#ERROR : Can't open dsspfile "1tsjA.bssp"
#ERROR : Can't open dsspfile "1lqkA.bssp"
#ERROR : Can't open dsspfile "1u6lA.bssp"
#ERROR : Can't open dsspfile "1cjxA2.bssp"
#ERROR : Can't open dsspfile "1ss4A.bssp"

## Summary of PDB Search
:121
    1e-12  13%  1ecsA  [d.32.1.2] BLEOMYCIN RESISTANCE PROTEIN
    2e-12  22%  1f1rA1 [d.32.1.3] HOMOPROTOCATECHUATE 2,3-DIOXYGENASE A:3 -- 147
    7e-12  12%  1bylA  [d.32.1.2] PROTEIN (BLEOMYCIN RESISTANCE PROTEIN)
    1e-11  12%  1mpyA1 [d.32.1.3] CATECHOL 2,3-DIOXYGENASE A:1 -- 145
    4e-11  12%  1r9cA  [d.32.1.2] GLUTATHIONE TRANSFERASE
    7e-11  16%  2pjsA1 [d.32.1.2] UNCHARACTERIZED PROTEIN ATU1953 A:3 -- 113
    1e-10  18%  1xqaA  [d.32.1.2] GLYOXALASE/BLEOMYCIN RESISTANCE PROTEIN
    2e-10  18%  1kllA  [d.32.1.2] MITOMYCIN-BINDING PROTEIN
    3e-10  10%  1jc4A  [d.32.1.4] METHYLMALONYL-COA EPIMERASE
    3e-10  16%  1dhyA2 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:133 --
    4e-10  14%  1twuA  [d.32.1.8] HYPOTHETICAL PROTEIN YYCE
    1e-09  11%  1zswA1 [d.32.1.10] GLYOXALASE FAMILY PROTEIN A:1 -- 144
    3e-09  11%  1cjxA1 [d.32.1.3] 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE A:4 -- 153
    6e-09  21%  1f9zA  [d.32.1.1] GLYOXALASE I
    6e-09  10%  1sp9A  [d.32.1.3] 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE
    1e-08  13%  1f1rA2 [d.32.1.3] HOMOPROTOCATECHUATE 2,3-DIOXYGENASE A:148 -- 323
    1e-08  18%  1bh5A  [d.32.1.1] LACTOYLGLUTATHIONE LYASE
    2e-08  14%  1tsjA  [d.32.1.7] CONSERVED HYPOTHETICAL PROTEIN
    4e-08  25%  1lqkA  [d.32.1.2] PROBABLE FOSFOMYCIN RESISTANCE PROTEIN
    1e-07  11%  1u6lA  [d.32.1.7] HYPOTHETICAL PROTEIN
    2e-07  14%  1cjxA2 [d.32.1.3] 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE A:154 -- 356
    1e-05  15%  1ss4A  [d.32.1.6] GLYOXALASE FAMILY PROTEIN
:121

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIDHFEIKVKDLQISEGFYRSFLAPLDYKMTFKTSSLISFLSPNSPHPGGDFWLTQGTQDPVHFAFLAEN
1ecsA           DQATPNLPSRDFDSTAAFYER----LGFGIVFRDAGWMILQRGDLMLEFFAHPGLDPLASWFSCCLLAEF
1f1rA1          -CAYMEIVVTDLAKSREFYVDVL---GLHVTEEDENTIYLRSLEEFIHHNLVLRQGPIAAVAAFAYRVKS
1bylA           -SAVPVLTARDVAGAVEFWTDRLGSRDFVEDDFAGVVRDDVTLFISAVQDQVVPDNTLAWVWVRGLDELY
1mpyA1          -PGHVQLRVLDMSKALEHYVELL---GLIEMDRDDQGRVYLKAWTEVDKFSLVLREADPGMDFMGFKVVD
1r9cA           -LSHMTFIVRDLERMTRILEGVFDEVYASDTEQFSLSREKFFLIGDIWVAIMQGEKLAERSYNHIAFKID
2pjsA1          -RVVANIATPEPARAQAFYGDI---LGXPVAXDHGWIVTHASPLEAH--AQVSFAREGGSGTDVPDLSIE
1xqaA           -IKHLNLTVADVVAAREFLEKY---FGLTCSGTRGNAFAVXRDNDGFITLXKGKEVQYPKTFHVGFPQES
1kllA           -ISLFAVVVEDXAKSXEFYRKXGSAPHTEAVLDGGIRLAWDTVETVRSYDPEWQAPTGGHRFAIAFEFPD
1jc4A           -IDHVAYACPDADEASKYYQETFIXXAPAAKLTEHXTQVQVXAPLNDESTVAKWLAKHNGRAGLHHXAWR
1dhyA2          -IGHFVRCVPDTAKAMAFYTEVLGFVLSD--IIDIVPAHFLHCNGRHHTIALAAFPIPKRIHHFMLQANT
1twuA           -QIRIARPTGQLDEIIRFYEEGLLKRIGEFSQHNGYDGVMFGLPHADYHLEFTQYEGGSTASLLVFYVPN
1zswA1          -HHHISMVTKNANENNHFYKNVLGLRRVKLFYGDKTGSPGTELSFFEIPLVGRTYRGTNAITRIGLLVPS
1cjxA1          -FEFIEFASPTPGTLEPIFEIMGTHRSKNVHLYRQGEINLILNNEPNSIASYFAAEHGPSVCGMAFRVKD
1f9zA           -LLHTMLRVGDLQRSIDFYTKVLGLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNYELGTAYGHIALS
1sp9A           RLDHAVGNVPELGPALTYVAGFTNSAVLASNDEMVLLPINEPVHGTKRKSQIQTYLEHNEGAGLQHLALM
1f1rA2          RLDHFNQVTPDVPRGRAYLEDLGFRVSEDIKDSDGVTYAAWMHRKQTVHDTALTGGNGPRMHHVAFATHE
1bh5A           LLQETMLRVKDPKKSLDFYTRVLGDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIA
1tsjA           KITTFLXFNNQAEEAVKLYTSLFEDSEIITXAKYGDPGTVQHSIFTLNGQVF----XAIDPISLFVTVKD
1lqkA           -LNHLTLAVADLPASIAFYRDLLWDQGAYLELGSLWLCLSREPQYGGPAADYT---------HYAF----
1u6lA           -IVPYLIFNGNCREAFSCYHQHLGGTADWKDKIXHARLVVGSFAASDNHPAYPYEGIKGCSISLNV---D
1cjxA2          -IDHLTHYRGRMVYWANFYEKLFGLTSKAMSAPDGMIRIPLNEESSKGAGQIEEFLMQFNGEGIQHVAFL
1ss4A           --DNVSIVVESLDNAISFFEEIGLNLEGRVTPDGHSRIELSRFLTPPTIADHRTAPVNALGYLRVXFTV-


                         .         .         *         .         .         .         .:140
query           KEEVQACYEAGLEAGGRDNGAPGYRSEHPIYYAAFMIDLDGNNIEVVCHKE
1ecsA           YRQCKSVGIQETSSGYPRIHAP--ELQGWGGTMAALVDPDGTLLRLIQNE-
1f1rA1          PAEVDAAEAYYKELGCRTERRKE-GFTKGIGDSVRVEDPLGFPYEFFYETE
1bylA           AEWSEVVSTNFRDASGPAMTEIG---EQPWGREFALRDPAGNCVHFV----
1mpyA1          EDALRQLERDLMAYGCAVEQLPA-GELNSCGRRVRFQAPSGHHFELYADKE
1r9cA           DADFDRYAERVGKLGLDMRPPRPGRS-------IYFYDDDNHMFELHTG--
2pjsA1          VDNFDEVHARILKAGLPIEYGPV--TEAWGVQRLFLRDPFGKLINIL----
1xqaA           EEQVDKINQRLKEDGFLVEPPKHA------AYTFYVEAPGGFTIEVXC---
1kllA           TASVDKKYAELVDAGYEGHLKPWNA--VWGQRYAIVKDPDGNVVDLFAP--
1jc4A           VDDIDAVSATLRERGVQLLYDEPKLGGGNRINFXHPKSGKGVLIELTQYPK
1dhyA2          IDDVGYAFDRLDAAGRITSLLG--RHTNDQTLSFYADTPSPMIEVEFGWGP
1twuA           AVELAAITSKLKHMGYQEVESEN---PYWSNGGVTIEDPDGWRIVFMNSKG
1zswA1          EDSLHYWKERFEKFDVKHSEMTT----YANRPALQFEDAEGLRLVLLVSNG
1cjxA1          ---SQKAYNRALELGAQPIHIDT---GPMELNLPAIKGIGGAPLYLIDRFG
1f9zA           VDNAAEACEKIRQNGGNVTREAG-PVKGGTTVIAFVEDPDGYKIELIEE--
1sp9A           SEDIFRTLREMRKRSSIGGFDFMPSPPPTYYQNLKKRVGDVLSDDQIKECE
1f1rA2          KHNIIQICDKMGALRISDRIERGGRHGVSNAFYLYILDPDGHRIEIYTQ--
1bh5A           VPDVYSACKRFEELGVKFVKKPD---DGKMKGLAFIQDPDGYWIQILNPNK
1tsjA           TIEXERLFNG-LKDEGAILXPK--TNXPPYREFAWVQDKFGVSFQLAL---
1lqkA           --GIAAADFARFAAQLRAHGVREWKQNRSEGDSFYFLDPDGHRLEAHV---
1u6lA           SKAEAERLFNALAEGGSVQXPLG---PTFWAASFGXFDRFGVAWXVNCEQD
1cjxA2          TDDLVKTWDALKKIGMRFMTAPPDT--YYEMLEGRLPDHGEPVDQLQARGI
1ss4A           -EDIDEXVSRLTKHGAELVGEVV--QYENSYRLCYIRGVEGILIGLAEEL-