[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF55344.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1c17M.bssp"

## Summary of PDB Search
:238
    1e-24  23%  1c17M  [f.18.1.1] ATP SYNTHASE SUBUNIT A
:238

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1c17M           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxKDYSLFFLCLFLFMVIANNLGLMTKLQTIDGTNWWSSPTANLQYDLTLSFLVILLTHIESVRRRGFK
1c17M           ---KLIAPLALTIFVWVFLMNLMDLLP---------IDLLPYIAEHVLGLPALRVVPSADVNVTLSMALG


                         +         .         .         .         .         *         .:210
query           KSIKSFMSPVFVIPMNILEEFTNFLSLALRIFGNIFAGEVMTSLLLLLSHQAIYWYPVAFGANLAWTAFS
1c17M           VFILILF-----YSIKMKSLLSKPVSLGLRLFGNMYAGELIFILIAGLL-----PWWSQWILNVPWAIFH


                         .         .         .         +         .         .         .:280
query           VFISCIQAYVFTLLTSVYLxxxxxxxxx
1c17M           ILIITLQAFIFMVLTIVYL---------