[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF55441.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1jcuA.bssp"
#ERROR : Can't open dsspfile "1k7jA.bssp"
#ERROR : Can't open dsspfile "1hruA.bssp"

## Summary of PDB Search
:47
    6e-06  21%  1jcuA  [d.115.1.1] CONSERVED PROTEIN MTH1692
    7e-05  18%  1k7jA  [d.115.1.1] PROTEIN YCIO
    6e-04  14%  1hruA  [d.115.1.1] YRDC GENE PRODUCT
:47

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxDKAGLERKFAAKERKRNKPGVVLCGSMDELCALAQLNPEIEAFx
1jcuA           ---DEDAVRRLFRVKGRSPHKPVSICVSCVDEIPRFSRPSGDAMEL-
1k7jA           ---DKNAXERICRIRQLPDGHNFTLXCRDLSELSTYSFVDNV-----
1hruA           ---SETAVXRLLELKQRPVDKGLILIAANYEQLKPYIDLTDVQRET-