[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF55442.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2etnA2.bssp"
#ERROR : Can't open dsspfile "1grjA1.bssp"
#ERROR : Can't open dsspfile "1grjA2.bssp"

## Summary of PDB Search
:160
    2e-15  26%  2etnA2 [d.26.1.2] ANTI-CLEAVAGE ANTI-GREA TRANSCRIPTION FACTOR A:78
    2e-14  36%  1grjA1 [a.2.1.1] GREA PROTEIN A:2 -- 79
    3e-14  40%  1grjA2 [d.26.1.2] GREA PROTEIN A:80 -- 158
:160

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxKTYPMTXXXXXXXXXXXXXXXXVRRPEVVERIKIARSYGDLSENSEYEAAKDEQAFVEGQISSLETK
2etnA2          ----------------------------------------------------------------------
1grjA1          ---QAIPMTLRGAEKLREELDFLKSVRRPEIIAAIAEAREHGDLKENAEYHAAREQQGFCEGRIKDIEAK
1grjA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IRYAEIVNSDxxAQDEVAIGKTVTIQEIGEDEEEVYIIVGSAGADAFAGKVSNESPIGQALIGKKTGDTA
2etnA2          --------------EVIGLGSVVELEDPATGERLSVQVVSPAEASVLENKISDASPMGKALLGHRVGDVL
1grjA1          LSNAQVIDVT------------------------------------------------------------
1grjA2          ------------NNGRVIFGATVTVLNLDSDEEQTYRIVGDDEADFKQNLISVNSPIARGLIGKEEDDVV


                         +         .         .         .         .         *         .:210
query           TIETPVGSYDVKILKVExxx
2etnA2          SLDTPKGKKEFRVVAIH---
1grjA1          --------------------
1grjA2          VI------------------