[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF55485.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1gz5A.bssp"
#ERROR : Can't open dsspfile "2iv7A1.bssp"
#ERROR : Can't open dsspfile "2bisA1.bssp"
#ERROR : Can't open dsspfile "2f9fA1.bssp"
#ERROR : Can't open dsspfile "2bfwA1.bssp"
#ERROR : Can't open dsspfile "1c3jA.bssp"
#ERROR : Can't open dsspfile "1rzuA.bssp"
#ERROR : Can't open dsspfile "1a14N.bssp"
#ERROR : Can't open dsspfile "1h3nA3.bssp"

## Summary of PDB Search
:347
    4e-29  10%  1gz5A  [c.87.1.6] ALPHA-TREHALOSE-PHOSPHATE SYNTHASE
    3e-25  16%  2iv7A1 [c.87.1.8] LIPOPOLYSACCHARIDE CORE BIOSYNTHESIS PROTEIN A:2
    2e-21  24%  2bisA1 [c.87.1.8] GLGA GLYCOGEN SYNTHASE A:1 -- 437
    2e-21  25%  2f9fA1 [c.87.1.8] FIRST MANNOSYL TRANSFERASE (WBAZ-1) A:2 -- 167
    3e-20  23%  2bfwA1 [c.87.1.8] GLGA GLYCOGEN SYNTHASE A:218 -- 413
    3e-15  10%  1c3jA  [c.87.1.1] BETA-GLUCOSYLTRANSFERASE
    1e-12  16%  1rzuA  [c.87.1.8] GLYCOGEN SYNTHASE 1
    1e-10   5%  1a14N  [b.68.1.1] NEURAMINIDASE
    1e-04  16%  1h3nA3 [c.26.1.1] LEUCYL-TRNA SYNTHETASE A:1 -- 225 A:418 -- 686
:347

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxSEKVAGQGVSGAYRELVRLLHRAAKDQLIVTENLPIEADVTHFHTIDFPYYLSTFQK
1gz5A           ---------------------------------------------------NNRIGFFLHIPFPTPEIFN
2iv7A1          ---------------------------------------------------DRVVGFNKXPGLDVYFAAD
2bisA1          -------------SEDVYGPGWDGLIRKAVTFGRASVLNDLLREEPLP---DVVHFHTVFAGALIKKYFK
2f9fA1          ----------------------------------------------------------------------
2bfwA1          ----------------------------------------------------------------------
1c3jA           ----------------------------LFKVISEMGLNVDII-----------SLKNGVYTKSFDEVDV
1rzuA           ----------------------------------------------------------------------
1a14N           ----------------------------------------------------------------------
1h3nA3          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KRSGRKIGYVHFLPATLEGSLKIPFFLKGIVKRYVFSFYNRMEHLVVVNPMFIEDLVAAGIPREKVTYIP
1gz5A           ALPTYDTLLEQLCDYDLLGFQ---------TENDRLAFLDCLSNLTRVTTRSAKSHTAWG-KAFRTEVYP
2iv7A1          VCYAEKVAQEKGFLYR-----LTSRYRHYAAFERATFEQGKSTKLXXLTDKQIADFQKHYTEPERFQILP
2bisA1          IPA---VFTIHRLNKS-----KLPAFYFHEAGLSELAPYPDIDIVTTVSRGYLIDEWGFFRNFEKITYVF
2f9fA1          ----------------------------------------------------------------------
2bfwA1          ----------------------------------------------------------------------
1c3jA           NDYDRLIVVNSNLAILS------AQKFMAKYKSKIYYLFTDIRLPFSQSAYLYTEEELLIKSPIKVISQG
1rzuA           ----------------------------------------------------------------VLHGIV
1a14N           ----------------------------------------------------------------------
1h3nA3          LPGGRGKQYVLVMFPYPSGDLHMGH-LKNYTMGDVLARFRRMQGYEVLHPMGWDA---FGLPAEN-AALK


                         +         .         .         .         .         *         .:210
query           NFVNKEKWHPLPQEEVVRLRTDLGLSDNQFIVVGAGQVQKRKGIDDFIRLAEELPQITFIWAGGFSFGGM
1gz5A           IGIEPKEIAKQAAGLPPKLAQLKAELKNVQNIFSVERLDYSKGLPERFLAYEALLEKYPQHHGKIRYAPT
2iv7A1          PGIYPDRKYSEQIPNSEIYRQKNGIKEQQNLLLQVGSDFGRKGVDRSISLPESLRHNTLLFVVG------
2bisA1          NGIDCSFWNESRDERKKSLLSKFGMDEGVTFMFIGRFDRGQKGVDVLLKAIEILSSKKEFQE--MRFIII
2f9fA1          ------------------------------FWLSVNRIYPEKRIELQLEVFKKLQDEKLYIVGWFSKGDH
2bfwA1          --IDCSFWNESRDERKKSLLSKFGMDEGVTFMFIGRFDRGQKGVDVLLKAIEILQEMRFIIIGK----GD
1c3jA           INLDIAKAAHKKVDNVIEFEYFPIEQKKTLDVIYGGSFRSGQRESKMVEFLFD-TGLNIEFFG-------
1rzuA           NGIDADVWNPATDHLIHDVAEHFRIDDGSPLFCVISRLTWQKGIDLMAEAVDEIVSLRLVVLGA----GD
1a14N           ----------------------------------------------------------------------
1h3nA3          FGVHPKDWTYANIRQAKESLRLMGILYDWDREVTTCEPEYYRWNQWIFKMWEK----------GLAYRAK


                         .         .         .         +         .         .         .:280
query           TDGYEHYKKIMENPPKNLIFPGIVSPERMRELYALADLFLLPSYNELFPMTILEAASCEAPIMLRDLDLY
1gz5A           SRGDVQAYQDIRHQLENEYLNQHFDRKLLXKIFRYSDVGLVTPLRDGXNLVAKEYVAAQDPANPGVLVLS
2iv7A1          QDKPRKFEALAEKLGVRSNVHFFSGRNDVSELXAAADLLLHPAYQEAAGIVLLEAITAGPVLTTAVCGYA
2bisA1          GKGLEGWARSLEEKHGNVVITEMLSREFVRELYGSVDFVIIPSYFEPFGLVALEAMCLGAIPIASAVGGL
2f9fA1          AERYA--RKIXKIAPDNVKFLGSVSEEELIDLYSRCKGLLCTAKDEDFGLTPIEAXASGKPVIAVNEGGF
2bfwA1          PELEGWARSLEEKHGNVKVITEMLSREFVRELYGSVDFVIIPSYFEPFGLVALEAMCLGAIPIASAVGGL
1c3jA           NAREKQFKNPKYPWTKAPVFTGKIPMNMVSEKNSQAIAALIIYNDNFITLRVWETMASDAVMLIDEEFTK
1rzuA           VALEGALLAAASRHHGRVGVAIGYNEPLSHLMQAGCDAIIIPSRFEPCGLTQLYALRYGCIPVVARTGLA
1a14N           ----------------TINSWHIYGKDNAVRIGEDSDVLVTREPYVSCDPDECRFYALSQ----------
1h3nA3          GLVNWLANEQVVEGRCWRHEDTPVEKRELEQWYLRITAYLLKDLEGLNWPEKVKAMQRAWIGRLRDWLIS


                         .         *         .         .         .         .         +:350
query           KVILEGNYRATAGREEMKEAILEYQANPAVLKDLKEKAKNISREYSEEHLLQIWLDFYEKxxxxxxx
1gz5A           QFAGAANELTSALIDEVAAALDRALTXSLAERISRHAELDVIVKNDINHWQECFISDLKQ-------
2iv7A1          HYIADANCGTVIAEEQLNEVLRKALTQSPLRXAWAENARHYADTQDLYSLPEKAADIIT--------
2bisA1          RDIITGILVKAGDPGELANAILKLELSRSDLSKFRENCKKRAMSFSWEKSAERYVKAYTG-------
2f9fA1          KETVINEYLVNADVNEIIDAXKKVSKNPDKFKDCFRRAK----------------------------
2bfwA1          RDIITNEILVKAGPGELANAILKLELSRSDLSKFRENCKKRAMSFS---------------------
1c3jA           HRIINDARFYVNNRAELIDRVNELKHSDVLRKEMLSIQHDILNKTRAKK------------------
1rzuA           DTVIDANHAALASKDGLKQAIVRYYHDPKLWTQMQKLG--MKSDVSWEKSAGLYAALYSQ-------
1a14N           -------------------------------------------------------------------
1h3nA3          RQRYWGTPIPMVHCEACGVVPVPEEELPVLLPDLKDVEDIRPKGKSPLEAHPEFYE-----------