[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF55614.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2axtU1.bssp"

## Summary of PDB Search
:226
    5e-04  11%  2axtU1 [a.60.12.2] PHOTOSYSTEM II 12 KDA EXTRINSIC PROTEIN U:37 --
:226

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQASVFEIAQKVLNNLSSLTDLKKMTLQELQ
2axtU1          ----------------------------------------EELVNVVDEKLGTAYGEKIDLNNTNIAAFI


                         .         .         *         .         .         .         .:140
query           SLSGIGRVKAIELQAMIELGHRIHKHETLEMESILSSQKLAKKMQQELGxxxxxxxxxxxxxxxxxxxxx
2axtU1          QYRGLYPTLA---KLIVKNAPYESVEDVLNIPGL--TERQKQILRENLE---------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2axtU1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxx
2axtU1          ----------------