[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF55668.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1jpuA.bssp"
#ERROR : Can't open dsspfile "1vljA.bssp"
#ERROR : Can't open dsspfile "1o2dA.bssp"
#ERROR : Can't open dsspfile "1dqsA.bssp"
#ERROR : Can't open dsspfile "1ujnA.bssp"
#ERROR : Can't open dsspfile "1oj7A.bssp"
#ERROR : Can't open dsspfile "1rrmA.bssp"
#ERROR : Can't open dsspfile "1kzhA.bssp"

## Summary of PDB Search
:362
    4e-94  52%  1jpuA  [e.22.1.2] GLYCEROL DEHYDROGENASE
    1e-43  17%  1vljA  [e.22.1.2] NADH-DEPENDENT BUTANOL DEHYDROGENASE
    3e-37  19%  1o2dA  [e.22.1.2] ALCOHOL DEHYDROGENASE, IRON-CONTAINING
    1e-32  18%  1dqsA  [e.22.1.1] PROTEIN (3-DEHYDROQUINATE SYNTHASE)
    4e-32  18%  1ujnA  [e.22.1.1] DEHYDROQUINATE SYNTHASE
    3e-26  24%  1oj7A  [e.22.1.2] HYPOTHETICAL OXIDOREDUCTASE YQHD
    1e-24  19%  1rrmA  [e.22.1.2] LACTALDEHYDE REDUCTASE
    2e-21  10%  1kzhA  [c.89.1.1] PHOSPHOFRUCTOKINASE
:362

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRIFASPSRYIQGENALFENAKSILDLGNYPILLCDQLVYDIVGKRFEDYLHRYGFHIVLALFNGEASDN
1jpuA           -RVFISPAKYVQGKNVITKIANYLEGIGNKTVVIADEIVWKIAGHTIVNELKKGNIAAEEVVFSGEASRN
1vljA           NFVFHNPTKIVFGRGTIPKIGEEIKNAGIKVLFLYGGGSIKKNGDQVVDSLKKHGIEWVE--VSGVKPNP
1o2dA           VWEFYXPTDVFFGEKILEKRGNIIDLLGKRALVVTGKSSSKKNGSLDDLKKLLDETEISYEIFDENPSFD
1dqsA           ------------------------------YVLVTDTNIGSIYTPSFEEAFRKRAALLIYNRPPGEVSKS
1ujnA           ---EPVPYPILVGEGVL----KEVPPLAGPAALLFDRRVEGFAQEVAKALGVRHL--LGLPGGEAAKSLE
1oj7A           ---LHTPTRILFGKGAIAGLREQIPHDARVLITYGGGSVKKTVLDQVLDALKG----MDVLEFGGNPAYE
1rrmA           ------------GRGAVGALTDEVKRRGQKALIVTDKTLVQCVVAKVTDKXDAAG--LAWAIYDGVVPNT
1kzhA           ------------------------------PLGLLENDKIELTESLINSYRNTGGFDIVSSGRTKIETEE


                         .         .         *         .         .         .         .:140
query           EINRVVALAEKENCDSIIGLGGGKTIDSAKAIADLIEKPVIIAPTIASTDAPVSALSVIYTDEGAFDHYL
1jpuA           EVERIANIARKAEAAIVIGVGGGKTLDTAKAVADELDAYIVIVPTAASTDAPTSALSVGV-----FESYR
1vljA           VLSKVVEVAKKEKVEAVLGLYEGDIWDAFIGKYQIEKALPIFDLTISATGTEMNGNAVITNEKTKEKYGV
1o2dA           NVXKAVERYRNDSFDFVVGLGGGSPXDFAKAVAVLLKLPVVEIPTTAGTGSEVTPYSILTDPEGNKRGCT
1dqsA           RKADIEDWMLSQNPTVVIALGGGVIGDLTGFVASTYMRRYVQVPTTLLADSSIGGKTAIDTPLGKNLIGA
1ujnA           VYGKVLSWLAEKGLPRNATLGGGTLTDGFVAATYLRGVAYLAFPTTTLAIVDASVGGKTGINLPEGKNLV
1oj7A           TLMNAVKLVREQKVTFLLAVGGGSVLDGTKFIAAAANIPMGCVLTLPATGSESNAGAVI-SRKTTGDKQA
1rrmA           VVKEGLGVFQNSGADYLIAIGGGSPQDTCKAIGIISNVPILAIPTTAGTAAEVTINYVITDEEKRRKFVC
1kzhA           HYNKALFVAKENNLNAIIIIGGDDSNTNAAILAEYFKKRNDHIEISFGFDSATKIYSELIGNLCR--DAM


                         +         .         .         .         .         *         .:210
query           FYSKNPDLVLVDTKVISQAPKRLLASGIADGLATWVEARAVMQANGKTMLGQQQTLAGVAIAKKCEETLF
1jpuA           FYKKNPDLVLVDTKIIANAPPRLLASGIADALATWVEARSVIKSGGKTMAGGIPTIAAEAIAEKCEQTLF
1vljA           SSKALPKVSIIDPSVQFTLPKEQTVYGAVDAISHILEYYFDGSSP----------EISNEIAEGTIRTIM
1o2dA           L--XFPVYAFLDPRYTYSXSDELTLSTGVDALSHAVEGYLSRKSTPPSD----------ALAIEAXKIIH
1dqsA           IW--QPTKIYIDLEFLETLPVREFINGMAEVIKTAAISSTALEENAETILKAVRRRF--EGTEEILKARI
1ujnA           GAFHFPQGVYAELRALKTLPLPTFKEGLVEAFKHGLIAGDEALLKVEDL-----TPQSPRLEAFLARAVA
1oj7A           FHSAHPVFAVLDPVYTYTLPPRQVANGVVDAFVHTVEQYVTKPVDAKIH---------DRFAEGILLTLI
1rrmA           VDPHDPQVAFIDADXXDGXPPALKAATGVDALTHAIEG---YITRGAWALTDALHIKAIEIIAGALRGSV
1kzhA           STKKYWHFVKLMGRSASHVALECALKTHPNICIVSEEVLAKKKTLSEIIDEMVSVILKRSLNGDGVVIVP


                         .         .         .         +         .         .         .:280
query           ADGLQAMAACEAKVVTPALENIVEANTXXXXXXXXXXXXXXXHAIHNGFTALTGDIHHLTHGEKVAYGTL
1jpuA           KYGKLAYESVKAKVVTPALEAVVEANTLLSGLGFESGGLAAAHAIHNGFTALEGEIHHLTHGEKVAFGTL
1vljA           KMTER---LIEKPDDYEARANLAWSATIALNGTMAVGRRGGEWACHRIEHSLSADIAHG-AGLAIVFPAW
1o2dA           RNLPKAIEGNRE-----ARKKXFVASC-LAGXVIAQTGTTLAHALGYPLTTEKGIKHGKATGXVLPF--V
1dqsA           LASARHKAYVVS---ADEREGGLRN------------LLNWGHSIGHAIEAILT--PQILHGECVAIGMV
1ujnA           VKVRVTEEDPLEKGKRRLL----------------NLGHTLGHALEAQTR------HALPHGMAVAYGLL
1oj7A           EDGPKALKEPENYD---VRANVMWAAT-QALNGLIGAGVPQDWATHMLGHELTA-MHGLDHAQTLAYAER
1rrmA           AGDKDALGQYVA---GXGFSNV---------------GLGLVHGXAHPLGAFYNTPHGVANGEKYRIARV
1kzhA           EGLIEFIPEVKSLMLELCDIFDKNEGEFKGLNIEKMKEIFVAKLSDYMKGVY----LSLPLFIQFELI-K


                         .         *         .         .         .         .         +:350
query           VQLLLENRPKEELDKYIEFYKKIGMPTTLKEMHLDQVGYDDLIKVGKQATMEGETIHQMPFKISPSDVAQ
1jpuA           VQLALEEHSQQEIERYIELYLCLDLPVTLEDIKLKDASREDILKVAKAATAEGETIH-NAFNVTADDVAD
1vljA           MKYVYRKNPAQFIEAFKNWLKKVGAPVSLKDAGIPEEDIDKIVLLVEKNLKPKGASLGRIMVLEREDVRE
1o2dA           XEVXKEEIPHIFGGSLLKFLKELGLYEKVSSEELEKW---------VEKGSRAKHLKNTPGTFTPEKIRN
1dqsA           KEAELARHKGVAVSRIVKCLAAYGLPTSLKDARIRKLTAGKHCSV-------------------------
1ujnA           YAALL-----------------------------------------------------------------
1oj7A           VWNITEGSDDERIDAAINFFEQLGVPTHLSDYGLDGSSIPALLK--------------------------
1rrmA           XGVKVEGXSLEEVEAVFALNRDVGIPPHLRDVGVRK---EDIPALAQAA-LDDVCTGGNPREATLEDIVE
1kzhA           SILERDPH-GNFNVSRVPTEKLFIEMIQSRLND-------------------------------------


                         .         .         .         .         *         .         .:420
query           AIIAVDAYxxxx
1jpuA           AIFAADQY----
1vljA           ILKLAA------
1o2dA           IYREALG-----
1dqsA           ------------
1ujnA           ------------
1oj7A           ------------
1rrmA           ------------
1kzhA           ------------