[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF55766.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ya7O1.bssp"
#ERROR : Can't open dsspfile "1bxdA.bssp"
#ERROR : Can't open dsspfile "1f51A.bssp"
#ERROR : Can't open dsspfile "1vpkA1.bssp"
#ERROR : Can't open dsspfile "1ys3A1.bssp"
#ERROR : Can't open dsspfile "1wj5A.bssp"
#ERROR : Can't open dsspfile "1aj6A.bssp"
#ERROR : Can't open dsspfile "1b3qA3.bssp"
#ERROR : Can't open dsspfile "2aswA1.bssp"
#ERROR : Can't open dsspfile "1mu5A3.bssp"
#ERROR : Can't open dsspfile "1r62A.bssp"
#ERROR : Can't open dsspfile "1oanA1.bssp"
#ERROR : Can't open dsspfile "1bknA2.bssp"
#ERROR : Can't open dsspfile "1qr0A2.bssp"
#ERROR : Can't open dsspfile "1a4hA.bssp"

## Summary of PDB Search
:532
    1e-17  10%  1ya7O1 [a.24.8.1] PROTEASOME ACTIVATOR PROTEIN PA26 O:4 -- 231
    2e-08  14%  1bxdA  [d.122.1.3] PROTEIN (OSMOLARITY SENSOR PROTEIN (ENVZ))
    5e-07  12%  1f51A  [d.123.1.1] SPORULATION INITIATION PHOSPHOTRANSFERASE B
    9e-07   9%  1vpkA1 [d.131.1.1] DNA POLYMERASE III, BETA SUBUNIT A:1 -- 120
    1e-06  20%  1ys3A1 [d.122.1.3] SENSOR-TYPE HISTIDINE KINASE PRRB A:299 -- 446
    2e-05  12%  1wj5A  [a.4.5.59] HYPOTHETICAL PROTEIN (RIKEN CDNA 0610009H20)
    3e-05  14%  1aj6A  [d.122.1.2] GYRASE
    3e-05  23%  1b3qA3 [d.122.1.3] PROTEIN (CHEMOTAXIS PROTEIN CHEA) A:355 -- 539
    6e-05  14%  2aswA1 [a.274.1.1] HYPOTHETICAL PROTEIN AF1503 A:278 -- 331
    8e-05  19%  1mu5A3 [d.122.1.2] TYPE II DNA TOPOISOMERASE VI SUBUNIT B A:10 --
    1e-04   9%  1r62A  [d.122.1.3] NITROGEN REGULATION PROTEIN NR(II)
    2e-04  20%  1oanA1 [b.1.18.4] ENVELOPE GLYCOPROTEIN A:298 -- 394
    2e-04  28%  1bknA2 [d.122.1.2] MUTL A:20 -- 216
    2e-04  10%  1qr0A2 [d.150.1.1] 4'-PHOSPHOPANTETHEINYL TRANSFERASE SFP A:102 --
    7e-04  18%  1a4hA  [d.122.1.1] HEAT SHOCK PROTEIN 90
:532

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ya7O1          ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1f51A           ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1wj5A           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1b3qA3          ----------------------------------------------------------------------
2aswA1          ----------------------------------------------------------------------
1mu5A3          ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1a4hA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ya7O1          ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1f51A           ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1wj5A           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1b3qA3          ----------------------------------------------------------------------
2aswA1          ----------------------------------------------------------------------
1mu5A3          ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1a4hA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ya7O1          ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1f51A           ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1wj5A           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1b3qA3          ----------------------------------------------------------------------
2aswA1          ----------------------------------------------------------------------
1mu5A3          ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1a4hA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKQVVDLVESIQVIAQGEXG
1ya7O1          ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1f51A           ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1wj5A           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1b3qA3          ----------------------------------------------------------------------
2aswA1          ---------------------------------------------------RPIIELSNTADKIAEGNLE
1mu5A3          ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1a4hA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RRIDISEKDQELLLIAETTNDMLDRLEKNIHDIYQLELSQKDANMRALQAQINPHFMYNTLEFLRMYAVM
1ya7O1          ---------------------------QNLRDSYTSFAVIEEWAAGTLQGIAKAAAEAHGVIRNSTYGRA
1bxdA           ----------------------------------------------------------------------
1f51A           ------------------------------------DTALTNELIHLLGHS--RHDWMNKLQLIKGNLSL
1vpkA1          ---------------------------------------------------------------------M
1ys3A1          ----------------------------------------------------------------------
1wj5A           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1b3qA3          ----------------------------------------------------------------------
2aswA1          AEVPHQNRADEIGILAKSIERLRRSLKVAM----------------------------------------
1mu5A3          ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1a4hA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           QSQDELADIIYEFSSLLRNNISDERETLLKQELEFCRKYSYLCMVRYPKSIAYGFKIDPELENMKIPKFT
1ya7O1          QA-EKSPEQLLGVLQRYQDLCHN-----VYCQAETIRTVIAIRIPEHKEEDNLGVAVQHALKIIDELEIK
1bxdA           -----------------------------------------------GYEREIETALYPGSIEVKMHPLS
1f51A           QKYDRVFEMIEE---MVIDAKHESKLSNLKTPHLAFDFLTFNWKTHYMTLEYEVLGEIKDLSAYDQKLAK
1vpkA1          KVTVTTLELKDKASKALAKKSVKPILAGFLFEVKDGNFYICATDLETGVKATVNAAEISGEARFVVPGDV
1ys3A1          ------------------------------------------------PDLDVSLVPSPTCI-IVGLPAG
1wj5A           ------------------TSLLSEKIKEFLQEKKMQSFYQQLETVESLQSLASRPVTHSTGSDQVELKDS
1aj6A           ------------------------------------------------KGLDAVRKRPGMYIGDTDDGTG
1b3qA3          ----------------------------------------------------------------------
2aswA1          ----------------------------------------------------------------------
1mu5A3          ------------------------------------------------------FKRNPELAGFPNPARA
1r62A           ---------------------------------------------ELPDNVRLIRDYDPSLPELAHDPDQ
1oanA1          ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1a4hA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           LQPLVENYFAHGVDHRRTDNVISIKALKQDGFVEILVVDNGRGMSAEKLANIREKLSQRYFEHQASYSDQ
1ya7O1          TLGSGEKSGSGGAPTPIGMYALREYLSARSTVEDKLL--GGGSQSPSLLLELRQI-------------DA
1bxdA           IKRAVANMVVNAARY--GNGWIKVSSGTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGL
1f51A           LMRKLFHLFDQAVSRESENHLTVSLQTDHPRQLILYLDFHGAFADPSAFDDIRQN---------------
1vpkA1          IQKMVKVLPDEITELSLEGDALVISSGSTVFRITTMPADEFPEIT-------------------------
1ys3A1          LRLAVDNAIANAVKHGGATLVQLSAVSSRAGVE-IAIDDNGSGVPEG----ERQVVFERFS---------
1wj5A           TSGVAQRVFKNALQLLQEKGLVFQRDSGSDKLYYVTTKDKDLQSGPS-----------------------
1aj6A           LHHMVFEVVDNAIDEALAGHCKEIIV-TIHADNSVSVQDDGRGIPTGIV----SAAEVIMTVLHAGG---
1b3qA3          LLHLLRNAIDHGAKGKPPIGTLILSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESKAATLVPG
2aswA1          ----------------------------------------------------------------------
1mu5A3          LYQTVRELIENSLDATDVHGILPNIKITIDQIYKVNVVDNGIGIPPQ----EVPNAFGRVLYSKYVNRQT
1r62A           IEQVLLNIVRNALQALGPEGGEII----------LRTRTAFQLTLHGERYRL--------AARIDVEDNG
1oanA1          --------------------VVKEIAETQHGTIVIRVQYEGDGSPCKIPFEIMD------------LEKR
1bknA2          PASVVKELVENSLDAGATRIDIDIER---GGAKLIRIRDNGCGIKKDELA--------------------
1qr0A2          --------------QPIGIDIEKTKPISLKRFFSKTEYSDLLAKDKDEQ----TDYFYHLWSMKESFIKQ
1a4hA           ---------------------LFIRITPKPEQKVLEIRDSGIGMTKAELINNLGKSGTKAFMEALSAGAD


                         *         .         .         .         .         +         .:560
query           RQSIGIVNVHERFVLYFGDRYAITIESAEQAGVQYRITIQDE
1ya7O1          DFMLKVELATTHLSTMVRAVINA-------------------
1bxdA           GLAI-----VQRIVDNHNGM--LELGTSERGGLSIRAWL---
1f51A           ------------------------------------------
1vpkA1          ------------------------------------------
1ys3A1          ---LGLALVAQQAQLHGG---TASLENSPLGGARLVLRL---
1wj5A           ------------------------------------------
1aj6A           ------------------------------------------
1b3qA3          FSGVGMDVVKNVVESLNGS---MGIESEKDKGTKVTIRL---
2aswA1          ------------------------------------------
1mu5A3          RGMYGLVKAAVLYSQMHQDKPIEIETSPVNSKRIYTFKLKID
1r62A           PIGLGLSIARNLIDQHSGK---IEFTSWPG-HTEFSVYL---
1oanA1          HVLGRLITVNPIVTEKDSP---VNIEAEPPFGDSYIIIG---
1bknA2          ------------------------------------------
1qr0A2          EGKLSLPLDSFSVRLHQDGQV--SIELPDSHSPCYIKTY---
1a4hA           VSMIGQFGVGFYSLFLVADRVQVISKSNDDEQYIWESNAGGS