[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF55806.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "1m3eA1.bssp"
#ERROR : Can't open dsspfile "1ex6A.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1pf4A1.bssp"
#ERROR : Can't open dsspfile "1khbA1.bssp"
#ERROR : Can't open dsspfile "1t06A.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "1qhlA.bssp"
#ERROR : Can't open dsspfile "1bgxT2.bssp"
#ERROR : Can't open dsspfile "1mukA.bssp"
#ERROR : Can't open dsspfile "2yyeA2.bssp"
#ERROR : Can't open dsspfile "1ohcA1.bssp"
#ERROR : Can't open dsspfile "1es6A2.bssp"
#ERROR : Can't open dsspfile "1f2t.1.bssp"
#ERROR : Can't open dsspfile "1bmfA3.bssp"
#ERROR : Can't open dsspfile "1jjvA.bssp"
#ERROR : Can't open dsspfile "1f46A.bssp"
#ERROR : Can't open dsspfile "2iqhA1.bssp"
#ERROR : Can't open dsspfile "1tljA.bssp"
#ERROR : Can't open dsspfile "1fl9A.bssp"
#ERROR : Can't open dsspfile "1kgdA.bssp"
#ERROR : Can't open dsspfile "1nijA1.bssp"
#ERROR : Can't open dsspfile "1mjgM.bssp"
#ERROR : Can't open dsspfile "2vgmA3.bssp"
#ERROR : Can't open dsspfile "1jalA1.bssp"
#ERROR : Can't open dsspfile "1pv4A3.bssp"
#ERROR : Can't open dsspfile "2fggA1.bssp"
#ERROR : Can't open dsspfile "1xbtA1.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"
#ERROR : Can't open dsspfile "1g6oA.bssp"
#ERROR : Can't open dsspfile "1ffhA2.bssp"
#ERROR : Can't open dsspfile "1c4oA1.bssp"
#ERROR : Can't open dsspfile "1iqrA2.bssp"
#ERROR : Can't open dsspfile "1mm8A.bssp"
#ERROR : Can't open dsspfile "1urjA.bssp"
#ERROR : Can't open dsspfile "1zs3A1.bssp"
#ERROR : Can't open dsspfile "3cddA1.bssp"
#ERROR : Can't open dsspfile "1ak2A1.bssp"
#ERROR : Can't open dsspfile "2v3jA1.bssp"
#ERROR : Can't open dsspfile "1zp6A1.bssp"
#ERROR : Can't open dsspfile "1j1zA2.bssp"
#ERROR : Can't open dsspfile "1t3wA.bssp"
#ERROR : Can't open dsspfile "2gx8A1.bssp"
#ERROR : Can't open dsspfile "2qgmA1.bssp"
#ERROR : Can't open dsspfile "2f9hA1.bssp"
#ERROR : Can't open dsspfile "2axpA1.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1bs2A1.bssp"
#ERROR : Can't open dsspfile "1l3aA.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "1dhyA1.bssp"
#ERROR : Can't open dsspfile "2pa7A1.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "2gk3A1.bssp"
#ERROR : Can't open dsspfile "1s9hA.bssp"
#ERROR : Can't open dsspfile "1jb1A.bssp"
#ERROR : Can't open dsspfile "1i1qA.bssp"
#ERROR : Can't open dsspfile "1poiA.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "1jbkA.bssp"
#ERROR : Can't open dsspfile "1rkbA.bssp"
#ERROR : Can't open dsspfile "1cd5A.bssp"
#ERROR : Can't open dsspfile "1viaA.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1dnpA2.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1np6A.bssp"
#ERROR : Can't open dsspfile "1e3mA2.bssp"
#ERROR : Can't open dsspfile "1em8A.bssp"
#ERROR : Can't open dsspfile "1tmkA.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "1atrA1.bssp"
#ERROR : Can't open dsspfile "1sbxA.bssp"
#ERROR : Can't open dsspfile "2ancF1.bssp"
#ERROR : Can't open dsspfile "1esmA.bssp"
#ERROR : Can't open dsspfile "3cddA2.bssp"
#ERROR : Can't open dsspfile "1gm5A1.bssp"
#ERROR : Can't open dsspfile "1o7d.2.bssp"
#ERROR : Can't open dsspfile "1v47A1.bssp"
#ERROR : Can't open dsspfile "1w1wA.bssp"
#ERROR : Can't open dsspfile "1f8xA.bssp"
#ERROR : Can't open dsspfile "1ni3A1.bssp"
#ERROR : Can't open dsspfile "1udwA.bssp"
#ERROR : Can't open dsspfile "1xl3C1.bssp"
#ERROR : Can't open dsspfile "2vnuD1.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "1g8yA.bssp"
#ERROR : Can't open dsspfile "1ii8.1.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "1vhhA.bssp"
#ERROR : Can't open dsspfile "1v37A.bssp"
#ERROR : Can't open dsspfile "1iioA.bssp"
#ERROR : Can't open dsspfile "1t9hA2.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "1b77A2.bssp"
#ERROR : Can't open dsspfile "1a4iA2.bssp"
#ERROR : Can't open dsspfile "1g8fA3.bssp"
#ERROR : Can't open dsspfile "1mi8A.bssp"
#ERROR : Can't open dsspfile "1tueA.bssp"
#ERROR : Can't open dsspfile "1l7lA.bssp"
#ERROR : Can't open dsspfile "1qhdA1.bssp"
#ERROR : Can't open dsspfile "1uouA3.bssp"
#ERROR : Can't open dsspfile "1odfA.bssp"
#ERROR : Can't open dsspfile "1yvuA2.bssp"
#ERROR : Can't open dsspfile "1puoA2.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "1oa8A.bssp"
#ERROR : Can't open dsspfile "1zbsA1.bssp"
#ERROR : Can't open dsspfile "1yj5A2.bssp"
#ERROR : Can't open dsspfile "1l1oA.bssp"
#ERROR : Can't open dsspfile "1dxeA.bssp"
#ERROR : Can't open dsspfile "1jqjA2.bssp"

## Summary of PDB Search
:234
    3e-37  25%  1sgwA  [c.37.1.12] PUTATIVE ABC TRANSPORTER
    1e-31  26%  1b0uA  [c.37.1.12] HISTIDINE PERMEASE
    5e-30  17%  1e69A  [c.37.1.12] CHROMOSOME SEGREGATION SMC PROTEIN
    2e-28   9%  1m3eA1 [c.124.1.2] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
    3e-28  11%  1ex6A  [c.37.1.1] GUANYLATE KINASE
    1e-26  22%  1l7vC  [c.37.1.12] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    8e-26  21%  1q3hA  [c.37.1.12] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-24  25%  1ji0A  [c.37.1.12] ABC TRANSPORTER
    6e-24  22%  1pf4A1 [c.37.1.12] TRANSPORT ATP-BINDING PROTEIN MSBA A:321 -- 564
    7e-22   6%  1khbA1 [c.91.1.1] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    9e-22   8%  1t06A  [a.118.1.17] HYPOTHETICAL PROTEIN
    2e-21   7%  1e9rA  [c.37.1.11] CONJUGAL TRANSFER PROTEIN TRWB
    3e-21  14%  1qhlA  [c.37.1.12] PROTEIN (CELL DIVISION PROTEIN MUKB)
    2e-20  12%  1bgxT2 [c.120.1.2] TAQ DNA POLYMERASE T:1 -- 173
    6e-20  14%  1mukA  [e.8.1.4] MINOR CORE PROTEIN LAMBDA 3
    1e-19   7%  2yyeA2 [d.139.1.1] SELENIDE, WATER DIKINASE A:155 -- 336
    2e-19  15%  1ohcA1 [c.45.1.1] CDC14B2 PHOSPHATASE A:42 -- 198
    3e-19  10%  1es6A2 [b.31.1.1] MATRIX PROTEIN VP40 A:201 -- 321
    7e-19  33%  1f2t.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    3e-18   6%  1bmfA3 [c.37.1.11] BOVINE MITOCHONDRIAL F1-ATPASE A:95 -- 379
    3e-18  12%  1jjvA  [c.37.1.1] DEPHOSPHO-COA KINASE
    4e-18   7%  1f46A  [d.129.4.1] CELL DIVISION PROTEIN ZIPA
    7e-18  10%  2iqhA1 [e.75.1.1] NUCLEOCAPSID PROTEIN A:21 -- 489
    9e-18   9%  1tljA  [d.282.1.1] HYPOTHETICAL UPF0130 PROTEIN SSO0622
    2e-17  14%  1fl9A  [c.37.1.18] HYPOTHETICAL PROTEIN HI0065
    2e-17  10%  1kgdA  [c.37.1.1] PERIPHERAL PLASMA MEMBRANE CASK
    6e-17  14%  1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223
    7e-17   9%  1mjgM  [e.26.1.3] CARBON MONOXIDE DEHYDROGENASE ALPHA SUBUNIT
    1e-16  14%  2vgmA3 [d.79.3.2] DOM34 A:278 -- 381
    2e-16   9%  1jalA1 [c.37.1.8] YCHF PROTEIN A:1 -- 278
    2e-16  10%  1pv4A3 [c.37.1.11] TRANSCRIPTION TERMINATION FACTOR RHO A:129 --
    3e-16  11%  2fggA1 [d.50.5.1] HYPOTHETICAL PROTEIN RV2632C/MT2708 A:4 -- 87
    4e-16  10%  1xbtA1 [c.37.1.24] THYMIDINE KINASE, CYTOSOLIC A:18 -- 150
    5e-16   9%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
    6e-16  15%  1g6oA  [c.37.1.11] CAG-ALPHA
    1e-15  15%  1ffhA2 [c.37.1.10] FFH A:89 -- 295
    1e-15  14%  1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:2
    1e-15  14%  1iqrA2 [c.28.1.1] PHOTOLYASE A:2 -- 171
    2e-15  12%  1mm8A  [c.55.3.4] TN5 TRANSPOSASE
    2e-15  11%  1urjA  [e.58.1.1] MAJOR DNA-BINDING PROTEIN
    4e-15  10%  1zs3A1 [a.25.1.1] LACTOCOCCUS LACTIS MG1363 DPSA A:3 -- 173
    4e-15   7%  3cddA1 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:181 -- 348
    4e-15  11%  1ak2A1 [c.37.1.1] ADENYLATE KINASE ISOENZYME-2 A:14 -- 146 A:177 --
    7e-15   7%  2v3jA1 [c.116.1.6] ESSENTIAL FOR MITOTIC GROWTH 1 A:23 -- 251
    1e-14  10%  1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181
    1e-14  11%  1j1zA2 [d.210.1.1] ARGININOSUCCINATE SYNTHETASE A:171 -- 395
    2e-14   9%  1t3wA  [a.236.1.1] DNA PRIMASE
    2e-14  11%  2gx8A1 [c.135.1.1] NIF3-RELATED PROTEIN A:4 -- 373
    3e-14   7%  2qgmA1 [c.150.1.3] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN A:33 -- 445
    3e-14  10%  2f9hA1 [b.161.1.1] PTS SYSTEM, IIA COMPONENT A:3 -- 123
    4e-14  12%  2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165
    4e-14  11%  1e6cA  [c.37.1.2] SHIKIMATE KINASE
    4e-14  15%  1cr0A  [c.37.1.11] DNA PRIMASE/HELICASE
    6e-14  10%  1bs2A1 [a.27.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:484 -- 607
    6e-14  10%  1l3aA  [d.18.1.2] P24: PLANT TRANSCRIPTIONAL REGULATOR PBF-2
    7e-14  10%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
    9e-14  14%  1dhyA1 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:1 -- 132
    1e-13  12%  2pa7A1 [b.82.1.1] DTDP-6-DEOXY-3,4-KETO-HEXULOSE ISOMERASE A:2 --
    2e-13  20%  1g6hA  [c.37.1.12] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    2e-13   6%  2gk3A1 [c.23.16.9] PUTATIVE CYTOPLASMIC PROTEIN A:8 -- 253
    3e-13  11%  1s9hA  [c.37.1.20] REP 40 PROTEIN
    6e-13   8%  1jb1A  [c.91.1.2] HPRK PROTEIN
    8e-13   5%  1i1qA  [d.161.1.1] ANTHRANILATE SYNTHASE COMPONENT I
    9e-13  12%  1poiA  [c.124.1.2] GLUTACONATE COENZYME A-TRANSFERASE
    1e-12   9%  1n25A  [c.37.1.20] LARGE T ANTIGEN
    1e-12   7%  1jbkA  [c.37.1.20] CLPB PROTEIN
    2e-12  11%  1rkbA  [c.37.1.1] PROTEIN AD-004
    3e-12   6%  1cd5A  [c.124.1.1] PROTEIN (GLUCOSAMINE 6-PHOSPHATE DEAMINASE)
    4e-12  10%  1viaA  [c.37.1.2] SHIKIMATE KINASE
    5e-12  11%  1d8jA  [a.4.5.18] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    5e-12   6%  1afrA  [a.25.1.2] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    8e-12   9%  1dnpA2 [c.28.1.1] DNA PHOTOLYASE A:1 -- 200
    1e-11  24%  1vplA  [c.37.1.12] ABC TRANSPORTER, ATP-BINDING PROTEIN
    1e-11  11%  1np6A  [c.37.1.10] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
    2e-11   9%  1e3mA2 [c.37.1.12] DNA MISMATCH REPAIR PROTEIN MUTS A:567 -- 800
    4e-11  17%  1em8A  [c.128.1.1] DNA POLYMERASE III CHI SUBUNIT
    1e-10  11%  1tmkA  [c.37.1.1] THYMIDYLATE KINASE
    1e-10  11%  1d6jA  [c.37.1.4] ADENOSINE-5'PHOSPHOSULFATE KINASE
    2e-10  12%  1atrA1 [c.55.1.1] HEAT-SHOCK COGNATE 70 KD PROTEIN A:2 -- 188
    2e-10   8%  1sbxA  [a.6.1.4] SKI ONCOGENE
    3e-10  11%  2ancF1 [c.37.1.1] GUANYLATE KINASE F:3 -- 206
    3e-10   8%  1esmA  [c.37.1.6] PANTOTHENATE KINASE
    4e-10   9%  3cddA2 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:2 -- 180
    7e-10   9%  1gm5A1 [a.24.21.1] RECG A:7 -- 105
    9e-10   8%  1o7d.2 [b.30.5.6] LYSOSOMAL ALPHA-MANNOSIDASE C:488 -- 585 D:603 --
    9e-10  10%  1v47A1 [b.122.1.3] ATP SULFURYLASE A:4 -- 135
    1e-09  16%  1w1wA  [c.37.1.12] STRUCTURAL MAINTENANCE OF CHROMOSOME 1
    3e-09  13%  1f8xA  [c.23.14.1] NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE
    4e-09  10%  1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306
    4e-09   8%  1udwA  [c.37.1.6] URIDINE-CYTIDINE KINASE 2
    5e-09  12%  1xl3C1 [a.243.1.1] PROTEIN TYPE A C:2 -- 92
    7e-09  19%  2vnuD1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP44 D:400 -- 494
    7e-09  14%  1ckvA  [d.137.1.1] PROTEIN (PROTEIN B)
    2e-08  10%  1g8yA  [c.37.1.11] REGULATORY PROTEIN REPA
    2e-08  23%  1ii8.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    2e-08   8%  1bccF  [f.27.1.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    4e-08  11%  1vhhA  [d.65.1.2] SONIC HEDGEHOG
    6e-08  10%  1v37A  [c.60.1.1] PHOSPHOGLYCERATE MUTASE
    1e-07  13%  1iioA  [a.39.4.1] CONSERVED HYPOTHETICAL PROTEIN MTH865
    4e-07  11%  1t9hA2 [c.37.1.8] PROBABLE GTPASE ENGC A:68 -- 298
    6e-07  11%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
    9e-07   8%  1b77A2 [d.131.1.2] PROTEIN (SLIDING CLAMP) A:111 -- 228
    1e-06   5%  1a4iA2 [c.58.1.2] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:2 --
    2e-06  13%  1g8fA3 [c.37.1.15] SULFATE ADENYLYLTRANSFERASE A:390 -- 511
    2e-06  12%  1mi8A  [b.86.1.2] DNAB INTEIN
    4e-06   7%  1tueA  [c.37.1.20] REPLICATION PROTEIN E1
    7e-06   7%  1l7lA  [b.18.1.16] PA-I GALACTOPHILIC LECTIN
    2e-05  10%  1qhdA1 [a.115.1.2] VIRAL CAPSID VP6 A:1 -- 148 A:333 -- 397
    2e-05   3%  1uouA3 [d.41.3.1] THYMIDINE PHOSPHORYLASE A:374 -- 480
    3e-05  15%  1odfA  [c.37.1.6] HYPOTHETICAL 33.3 KDA PROTEIN IN ADE3-SER2
    3e-05   9%  1yvuA2 [c.55.3.10] HYPOTHETICAL PROTEIN AQ_1447 A:315 -- 706
    5e-05   7%  1puoA2 [a.101.1.1] MAJOR ALLERGEN I POLYPEPTIDE, FUSED CHAIN 2, A:5
    8e-05   8%  1e2hA  [c.37.1.1] THYMIDINE KINASE
    9e-05  10%  1oa8A  [b.145.1.1] ATAXIN-1
    1e-04   7%  1zbsA1 [c.55.1.5] HYPOTHETICAL PROTEIN PG1100 A:108 -- 283
    1e-04  13%  1yj5A2 [c.37.1.1] 5' POLYNUCLEOTIDE KINASE-3' PHOSPHATASE A:351 --
    2e-04   9%  1l1oA  [b.40.4.3] REPLICATION PROTEIN A 14 KDA SUBUNIT
    5e-04  17%  1dxeA  [c.1.12.5] 2-DEHYDRO-3-DEOXY-GALACTARATE ALDOLASE
    6e-04  13%  1jqjA2 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:123 -- 244
:234

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRYITVEDLSFYYDKEPVLEHINYCVDSGEFVTLTGENGAAXTTLIKASLGILQPRIGKVAISKTNTQGK
1sgwA           ---LEIRDLSVGYDK-PVLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGVPITKV
1b0uA           ---LHVIDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNINLV
1e69A           -----------------SFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENLPPA
1m3eA1          ----------------TDAVEAVKDIPNGATVLVGGFGLCGIPENLIGALLKTGVKELTAVNFGLGLLLQ
1ex6A           -----------------------------RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVS-----STT
1l7vC           --------------ESTRLGPLSGEVRAGEILHLVGPNGAGKSTLLARXAGXTSGKGSIQPLEAWSATKL
1q3hA           ---EKVSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKH-----SGR
1ji0A           ---LEVQSLHVYYGAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDITNK
1pf4A1          ---VDVKDVTFTYQEKPALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDVRDY
1khbA1          -----------WLAEHMLVLGITNPEGEKKYLAAAFPSACGKTNLAMMNPSLPGWKVECVGDDIAWMKFD
1t06A           ----------------------------ERTKKIYISNGAHEPVFGVATGAMKPIAKKIKLLAEELYATG
1e9rA           ---GKLKRMTREKAKQVTVAGVPMPRDAERHLLVNGATGTGKSVLLRELAYTGLLRGDRMVINGDMLSKF
1qhlA           ---GKFRSLTLINWN--GFFARTFDLD-ELVTTLSGGNGAGKSTTMAAFVTALIPDLTLLLHGKLKAGVC
1bgxT2          ---------------------------------------------MRGMLPLFEPKGRVLLV--------
1mukA           MRARRHSYSSFSKLLEYLLVKW-----------RMCEAREPSVDLRLPLCAGIDPLNSDPFLKMVSLQST
2yyeA2          -------------------------AQVGQLLILTKPIGTGILIKGLKEGILKEEDINEAIENALNDKAR
1ohcA1          ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1bmfA3          PGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCII
1jjvA           ----------------------------TYIVGLTGGIGSGKTTIANLFTDLGVPLVDADVVARAKDSPL
1f46A           ----------------------------------------------EAVIIMNVAAHHGSELNGELLLNS
2iqhA1          -QANNGDDATAGLTH-MMIWHSNLNDATYQRTRALVRTGMDPRMC-SLMQGSTLPRRSGAAGAAVKGVGT
1tljA           --------LVWEELREKALNKIYHDKEIGYLDPDILGFLLAFYRNRNDVYTQ-SSCSGRITIVDAEMPWD
1fl9A           TQYIPDEFSMLRFGKKFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQGNVKSPTYTLVEEY
1kgdA           ----------------------------RKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPEE
1nijA1          --------------------------NPIAVTLLTGFLGAGKTTLLRHILNEQHGYKIAVIENEFGEVSV
1mjgM           TRGIKLTKIKLDLPINFGPAFEGESIRKGDMYVEMGGNRTPAFELVRTVSESEITDGKIEVIGPDIDQIP
2vgmA3          ----------------------------------------------------------------------
1jalA1          ----------------------------GFKCGIVGLPNVGKSTLFNALTKAGPFCTIEPNTGVVPMPDR
1pv4A3          ---ILFENLTPLHANSRLVLDLASPIGRGQRGLIVAPPKAGKTXLLQNIAQSIAYNHPDCVLXVLDERPE
2fggA1          ----------------------------------------------------------------------
1xbtA1          ----------------------------GQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLV------IK
1grqA           ----------------------------TRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMP
1g6oA           ---EEQGFYNLLDNKEQAISAIKDGIAIGKNVIVCGGTGSGKTTYIKSIXEFIPKEERIISIEDTEEIVF
1ffhA2          -------------------EARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLV--AADTQ
1c4oA1          ---FRYRGPSPKGDQPKAIAGLVEALRDGEFVTLLGATGTGKTVTMAKVIEALGRPALVLAPNKILAAQL
1iqrA2          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1urjA           ---TTGEALCERLGLDPVTEGFKEAVCINNTFLHLG--GSDKVTIGGAEVHRIPVYPLQLFMEPFNANHR
1zs3A1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1ak2A1          ----------------------------GVRAVLLGPPGAGKGTQAPKLAKNFCVCATGDMLRAMVASGS
2v3jA1          ----------------QAPPVLTSKDKITKRXIVVLAXASLETHKIYVLLNCDDHQ-GLLKKXGRDISEA
1zp6A1          ----------------------------GNILLLSGHPGSGKSTIAEALANLPGVPKVHFHSDDLWGYIK
1j1zA2          ----------------------------------------------------------------------
1t3wA           ------------------------------------------RTTXRILIGLLVQNPELATLVPPLENLD
2gx8A1          ----------KKVVVFVPVTHAEEVRKALGDAGAGHIGNYSHCTFSSEGTGTFVPRIETIIPASLQRKVI
2qgmA1          ----------------------------------------------------------------------
2f9hA1          ---------------------------------------------------------------QATVTEI
2axpA1          ------------------------------LIILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSGN
1e6cA           -----------------------------EPIFMVGARGCGMTTVGRELARALGYEFVDTDISGMTVADV
1cr0A           ------ESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGK----KVGLAML
1bs2A1          ----------------------------------------------------------------------
1l3aA           ------------------------------------------------------------------LTVE
1lw7A2          -------------------------PFFAKTVAILGGESSGKSVLVNKLAAVFNTTSAWEYGREFVFEKL
1dhyA1          ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1g6hA           MEILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNK
2gk3A1          ----------------------------------------------------------------------
1s9hA           -----LNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFPFND
1jb1A           --------------ERRSXHGVLVDIY-GLGVLITGDSGVGKSETALELVQRGHRLIA-DDRVDVYQQDE
1i1qA           TKVDRYSYVMHLVSRVELRHDLDALHAYRACMNMGTLSGAPKVRAMQLIADAEGQRRGS----------Y
1poiA           ----------------TLKDAIAKYVHSGDHIALGGFTTDKPYAAVFEILRQGITDLGDWDMLIGNGRVK
1n25A           --------------------CMVYNIPKKRYWLFKGPIDSGKTTLAAALLELCGGKALNVNLPLGVAIDQ
1jbkA           ---AEQGKLDPVIGRDEEIRRTVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLKGRRVLAL
1rkbA           ----------------------------LPNILLTGTPGVGKTTLGKEKSGLKYINVGDLAREEQLYDGY
1cd5A           AGQVSFKHVVTFNDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSY
1viaA           -----------------------------KNIVFIGFXGSGKSTLARALAKDLEQKFNQKVSEIFEQKRE
1d8jA           ----------------------------------------------------------------------
1afrA           ----------------EVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDPASDGF
1dnpA2          ----------------------------------------------------------------------
1vplA           ---VVVKDLRKRIGKKEILKGISFEIEEGEIFGLIGPNGAGKTTTLRIISTLIKPSSGIVTVFGKNVVE-
1np6A           ----------------------------IPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTHHEL
1e3mA2          ---IRITEGRHQVLNEPFIANPLNLSPQRRXLIITGPNXGGKSTYXRQTALIALXAYIGSYVPAQKVEIG
1em8A           ----------------------------------------------------------------------
1tmkA           ----------------------------GKLILIEGLDRTGKTTQCNILYKKLQPNCKLL------KFPE
1d6jA           ----------------TRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIR
1atrA1          -------------------KGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGD
1sbxA           ----------------------------------------------------------------------
2ancF1          ----------------------------GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQVLATGV
1esmA           ---SRLLNFYISSNLRLEQFLGTNGQRIPYIISIAGSVAV----------------------GKSTTARV
3cddA2          ---LKAGGKIYQGWTKRSLEAXSGAFDLEXTYKFLGNDAQYKAFIEPIKQGQACTIGGERVITGYVDDWV
1gm5A1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1w1wA           -----------------------------------------------------------IFLENENILIK
1f8xA           ----------------------------------------------------------------------
1ni3A1          -------------------------PGNNLKTGIVGXPNVGKSTFFRAITKSVLGNPANYPYATIDPEEA
1udwA           ----------------------------PFLIGVSGGTASGKSSVCAKIVQLLQKQVVILSQDSFY----
1xl3C1          ----------------------------------------------------------------------
2vnuD1          ---IRTRRAAELLDKRIVISIDSWKYPLGHFVRDLGTIESAQAETEALLLEHDVE---------------
1ckvA           ---AGIMGLKGKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPTVNVEDRAG-
1g8yA           ---HKPINILEFAAAPPPLDYVLPNMVAGTVGALVSPGGAGKSML----------------ALQLAAQIA
1ii8.1          ----------------------------------------------------------------------
1bccF           --------------------------------------------------------------SRWLEGIR
1vhhA           ----------------------------------------------------------------------
1v37A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1t9hA2          ---------------------------------------------------------------------T
1yr6A1          ------------------------------IVVFVGTAGSGKTTLTGEFGRYLEDNYKVAYVNLDTGVKE
1b77A2          ------------------VASVITEIKAEDLQQLLRVS-----RGLQIDTIAITNKDGKIVIKVEDSGLT
1a4iA2          ----------------------------------------------------------------------
1g8fA3          -------------------------PKQGFSIVLGNSLTVSREQLSIALLSTFLQFGGGRYYKIFEHNNK
1mi8A           ---VSIKDLLDEKFEIWAINEQTMKLESAK-VSRVFMTGKKLVYILKTRLGRTIKATANHDGWKRLDELS
1tueA           -QFLRYQQIEFITFLG-ALKSFLKGTPKKNCLVFCGPANTGKSYFGMSFIHFIQGAVISFVNSTSHLEPL
1l7lA           ------------------KGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQG
1qhdA1          ----------NFDNSSEYIENWNLQNRRQRTSVLADASETMLANVTSVR-QEYAIPVGPVFPPGMNWTDN
1uouA3          ----------------------------------------------------------------------
1odfA           ----TVLDYTIEFLDKYIPEWFETGNKCPLFIFFSGPQGSGKSFTSIQIYNHLM-----------EKYGG
1yvuA2          ----------------------------------------------------------------------
1puoA2          ----------------------------------------------------------ETCPIFYDVFFA
1e2hA           ----------------------------LLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRSETIAN
1oa8A           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1yj5A2          -----------------------------------GFPGAGKSTFIQEHLVSAGYVHVNRDTLGSWQRCV
1l1oA           ----------MMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTG-------------------------
1dxeA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KLRIAYLPQQIASFNAGFPSTVYEFVKSGRYPRKGWFRRLNAHDEEHIKASLDSVGMWEHRDKRLGSLSG
1sgwA           KGKIFFLPEEIIVPR---KISVEDYLKAVASLYGVKVNK-------NEIMDALESVEVLDLKKKLGELSQ
1b0uA           RDKRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKH---DARERALKYLAKVGIDERAGKYPVHLSG
1e69A           GSAFEENGEEITVARELGQGQIDRIVNAYQRVNESFNRFISLLFFGGEGRLEISIRKPGRRDQKLSLLSG
1m3eA1          SKQIKRXISSYVGENAEFERQYLAGELEVELTPQGTLAERIRAGGAGVPAFYTSTGYGTLVQEGGSPIKY
1ex6A           RTPRAGEVNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQVSKSGKTCILDIDMQGVKSV
1l7vC           ALHRAYLSQQ---QTPPFATPVWHYLTLHQHDKTRT---------ELLNDVAGALALDDKLGRSTNQLSG
1q3hA           VSFCSQFSWI-------MPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSG
1ji0A           VINRXGIALVPEGRRIFPELTVYENLXXGAYNRKDKEG----IKRDLEWIFSLFPRLKERLKQLGGTLSG
1pf4A1          KLRRHFALVSQNVHLFNDTIANNIAYAAEGEYTREQIEQAARQAHAMEFIENMPQGLDTVIGENGTSLSG
1khbA1          AQGHLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLASGVTITSWKN
1t06A           NYDAMYFAGIIA----DPKAMSESDFDRWIDGAYFYMLS-----DYVVAVTLSESNIAQDVADKWIASGD
1e9rA           GRDKDIILNPYDQR---TKGWSFFNEIRNDYDWQRYA----LSVVPRGKTDEAEEWASYGRLLLRETAKK
1qhlA           YSMLDTINSRLQQVAGRDRKDIKPFAIQGLPMSVQTETLNERQARVLPLNELKDEAMEGVQFKQFNSITD
1bgxT2          -DGHHLAYRTFHALK--GLTTSRGEPVQAVYGFAKSLLKALKEDGDAVIVVFDAKAPSFRHEAYGGYKAG
1mukA           RKYFAQTLFMAKTVS-GLDVNAIDSA--------LLRLRTLGADKKALTAQLLMVGLQESEDALAGKIML
2yyeA2          NLMLSLDATACTDVTGFGLLCKNSNIGARIFFEK--VPYYQLSENLVKKKIYPKGAIENLNFVKNYLKSN
1ohcA1          --ASNVHYFSI--DNELEYENFYADFGPLN-------LAMVYRYCCKINKKLKSITM--LRKKIVHFTGS
1es6A2          --------------------SFHPKLRPILLPNKNSADLTSPEKIQAIMTSLQDFKIVPIDPTK--NIMG
1f2t.1          --------------------------------------------------------VWEGKERPLTFLSG
1bmfA3          GQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAV
1jjvA           LSKIVEHFGAQILNR--------------------AALRERVFNHDEDKLWLNNLLHPAIRERMKQKLAE
1f46A           IQQAGFIFGDMNIY---HRHLSPDGSGPALFSLANMVKP---GTFDPEMKDFTTPGVTIFMQVPSYGELQ
2iqhA1          MVMIRMIKRGINRRTRIAYERMCNILKGKFQTA--AQRTMVDQVRESRNPGNAEFEDLIFLARSALILRG
1tljA           RKNSTIIFKNHLRITEQDLEDVLSKNQVRRLWLIVQGPIIHIYAKNIETG-WDILKIAREAGFKHSGILA
1fl9A           NIAGKMIYHFDLYRLADPEELEFMGIRDYFNTDSICLIEWSEKGQGILPEADILVNIDYYDDARNIELIA
1kgdA           NGKNYYFVSHD---------QMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVE-PQALK
1nijA1          DDQLIGRATQIKTLTNGCICSRSNELEDAL------LDLLDNLDKGNIQ--FDRLVIECTGMADPGPIIQ
1mjgM           EGSKLPLGILVDIYG------RKMQADFEGVLERRIHDFINYGEGLWHTGQRNINWLRVSKDAVAKGFRF
2vgmA3          ----------------------------------------------------------LHLNKDDDKAWY
1jalA1          LDALAEIVKPERILPTTMEFVDIAGLVAGASKGEGLGNKFLANIRETDA---IGHVVRCFENIDPLDDID
1pv4A3          EVTEXQRLVKGEVVASTFDEPASRHVQVAEXVI--------EKAKRLVEHKKDVIILLDSITR------L
2fggA1          -----------------------------------------SEHVGKTCQIDVLIEEHDERTRAKARLSW
1xbtA1          YAKDTRALPACLLRDVAQEALGVAVIGIDEG----QFFPDIVEFCEAMANAGKTVIVAALDGTFQRKPFG
1grqA           LKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARII-----IDDVFLGGAAAQERWRSFV
1g6oA           K-HHKNYTQLFFGGNITSADCLKSCLRXRPDRIILGELRSSEAYDFYNVL---CSGHKGTLTTLHAGSSE
1ffhA2          RPAAREQLRLL-----------------GEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAG
1c4oA1          AAEFRELFPENAVEYFISYYDYYQPEAYVPGKDLYIEKDASINPEIERLRHSTTRSLLTRRDVIVVASVS
1iqrA2          -----------------------------------WHRGDLLHDHPALLEALARGPVVGLVVLDPNNLKT
1mm8A           --------SSAALGDPRRTALVNVAAQLAKYSGKSI-TISSEGSKAAQEGAYRFIRNPNVSAEAI--RKA
1urjA           SIGEKFTYPLPFPLNRLLFEAVVGPA---AVALRSRNVDAVARAAAHLAFNHEGAALPADITFTAFAGGF
1zs3A1          ELDKAEIDHHKPTAGA-MLGHVLSNLFIENIRQAGIYAKSPVKCEYL----REIAQREVEYFFKISDLLL
3cddA1          -------------------------------------KTKAGVSLILGDNVKAARGRFSWRQRFSKFTIK
1ak2A1          ELGKKLKATMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEF
2v3jA1          RPDITHQCLLTLLDSPINKAGKLQVYIQTSRGILIEVNP-TVRIPRTFKRFSGLXVQLLHKLSIRSEEKL
1zp6A1          HGRIDPWLPQSHQQNRXIXQIAADVAGRYAKEGYFVILD-GVVRPDWLPAFTALARPLHYIVLRTTAAEA
1j1zA2          --DANLLHIS---YEGGVLEDPWAEPPKGMFRM--------TQDPEEAPDAPEYVEVE-FFEGDPVAVNG
1t3wA           ENKLPGLGLFRELVN--------TCLSQPGLTTGQLLEHYRGTNNAATLEKLSXWDDIADKNIAEQTFTD
2gx8A1          KAMVTAHPYEEVAY---DVYPLDNKGETLGLGKIGYLQEEMTLGQFA-------EHVKQSLDVKGARVVG
2qgmA1          -------------------------------------------GQSVQKNIVK--SIQSQANPLKTIEPS
2f9hA1          GKHAIDDSEKXIIL---FGETATDTLKQHAVIQSFPEKDQVTLAEGDHLK----IGDTNYTITKVGSFAN
2axpA1          EKEDNVIIDRFVYSNLVYAKKFKDYSILTERQLRFIEDKIKAKAKVVYLHADPSVIKKRLRVRGDEYIEG
1e6cA           VAAEGWPGFRRRESEALQAVATPNRVVATGGGMVLLEQNRQFMRAHGTVVYLFAPLRLQASLQAHQRPTL
1cr0A           EESVEETAEDLIGLHNRVRL------------RQSDSLKREIIENGKFDQWFDEL-FGNDTFHLYDSFAE
1bs2A1          ----------------------------------------------------------PYLQYAHSRLRS
1l3aA           PRSPEFSPLDSGAFKLSREGMVMLQFAPAAGVRQYDWSRKQV-FSLSVTEIGSIISLGKDSCEFFHDPNK
1lw7A2          GGDEQAMQY-------------------SDYPQXALGHQRYIDYAVRHSHKIAFIDTDFITTQAFCIQYE
1dhyA1          --------------------------------------------GYLGFAVKDVPAWDHFLTKSVGLMAA
2pa7A1          ----------------------------------------------------------FHAHKKLEQVLV
1g6hA           EPQTPQPLKEMTVLENLLIGEICPGESPLNSLFYKKWIPKEEEMVEKAFKILEFLKLSHLYDRKAGELSG
2gk3A1          ---LKVLFIG---ESWHIHXIHSKGYDSFTSSKYEEGATWLLECLRKGGVDIDYXPAHTVQIAFPESIDE
1s9hA           CVD----KMVIWWEEGKMTAKVVESAKAILGGSK-----VRVDQKCKSSAQIDPTPVIVTSNTNMCAVID
1jb1A           QTIVGAAPPILSHLLEIRGLGIIDVXNLFGAGAVREDTTIS-LIVHLENWTPDQLIFDVPVPKITVPVKV
1i1qA           GGAVGYFTAHGDLD---TCIVIRSALVENGIATVQAGAGIVLDSVPQ----SEADETRN--------KAR
1poiA           AYINCYTANS---GVTNVSRRFRKWFEAGKYSQDVIYMMWHAA-ALGLPFLPVTLMQGSGLTDEWGISKE
1n25A           FLVVFEDVKGTGGESRDLPSGQGINNLDNDYLDGSVKVNLEKKHLNKRTQIFPPGIVTMNEYSVPKTLQA
1jbkA           DMGALVAGAKYRGEFEERLKGVLNDLAKQEGNVILFIDELHTMVGAMDAGNLKPALARGELHCVGATTLD
1rkbA           DEEYDCPILDEDRV-VDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKL
1cd5A           GKIHLFMGGVSRTRIKTLTHDTRVANSRFFDNDVNQVPKYALTVGVGTLLDAEEVMILVLGSQLQAAVEG
1viaA           NFFREQEQKXADFFSS-CEKACIATGGGFVNVSNLEKAGFCIYLKADFEYLKKRLDKDEISKRPLFYDEI
1d8jA           --------------------------------------GYKFGVLAKIVNYMKTRHQRDEILDETQHLDI
1afrA           DEQVRELRERAKEIPDDYFVVLVGDMITEEALPTYQTMGRVDMRQIEKTIQYLIGSGMDPRTENSPYLGF
1dnpA2          -----------------------------------------ALAAACRNSSARVLALYIATPRQWATHNM
1vplA           --EPHEVRKLISYLPEEAGAYRNMQGIEYLRFVAGFYASSSSEIEEMVERATEIAGLGEKIKDRVSTYSK
1np6A           RKAGAAQTIVA------------------SQQRWALMTETPDEEELDLQFLASRMDTSKLDLILVEGFKH
1e3mA2          PIDRIFTRVGFXVEXTETANILHNATEYSLVLXDEIGRGTSTYDGLSLAWACA-ENLANKIKALTLFATH
1em8A           ----------------------------------------------------------------------
1tmkA           RSTRIGGLINEYLTDDSFQLSDQAIHLLFSANRWEIVDKIKKDLLEGKNIVMDRYVYSGVAYSAAKGTNG
1d6jA           FGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRK-----------DRDTARQLHEVATP
1atrA1          AAKDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFND
1sbxA           ------------------------------------------------------------------DRST
2ancF1          DVFLDIDWQGAQQIRQKMPHARSIFILPPSGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTAL
1esmA           LQALLSRWPEHRRVELITTDGFLHPNQVLKERGLXKKKGFPESYDXHRLVKFVSDLKSGVPNVTAPVYSH
3cddA2          PSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTDVGEPFQRIQIEQ
1gm5A1          --------------------EALPTLLEEFL-NEVEKMLKNQVNTRRI---HQLLKELDDPLLENKDLEE
1o7d.2          ---------------------------------------------ISICPLTQTAE-----RFQVIVYNP
1v47A1          ----------------------------------------------------------------------
1w1wA           AKNFLVFQGDVEQIAAQSPVELSRMFTFDYVS--DHLDAIYRELTGNASLTKYHATPPLKRFKDMEYLSG
1f8xA           -----------------------------------------------------------------GWFTD
1ni3A1          KVAVPDERFDWLCEAYKPKSRVPAFLTVFDIA---GLTKGASTGVGLGNAFLSHVRAVDAIYQVVRAFDD
1udwA           -------RVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYP
1xl3C1          --------------------------------------------PTPEIXVRFYQDLXRMFRLFPLGVFS
2vnuD1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1g8yA           GGPDLLEVGELPTGPVIYLPAEDPPTAIHHRLHALGAHLSAEERQAVADGLLIQPLIGSLPNIMAPEWFD
1ii8.1          -------------------------------------------------------ERPLTFLSGGERIAL
1bccF           KWYYNAAGFNKYGLMRDD--TIYENDDVKEAIRRLPENLYDDRMFRIKR-------ALDLNMRQQILPKE
1vhhA           -------------------------------------------KQFIPNVAEKTLGASGRYEGK--ITRN
1v37A           -----------------------------RLKGALPSLPAFSSDLLRARRTAELAGFSPRLYPELREIHF
1iioA           -----------------------------------------NSPEELMAALPN--GPDTTCKSGDVELKA
1t9hA2          DIEEEELGYTFPDIREKSSSCKFRGCLHLKEPK------------CAVKQAVEDGELKQYRYDHYVEFMT
1yr6A1          -------LPYEPSIDVREFVTVEEIMREGYGPNGAIVESYDRLMEKFNEYLNKILRLEKENDYVLIDTPG
1b77A2          RPKYSLTLTDYDGSNNFNFVINMANMKIQP----GNYKVMLWGAGDKVAAKFESSQVSYIAMEADSTHD-
1a4iA2          ----------------------------------------------------------------------
1g8fA3          T-ELLSLIQDFIGSPDQWEDDKDSVVGKQNVYLLDTSDEPISHIVQKVVLFLEDNGFFV-----------
1mi8A           LKEHIALPRKSDIS---WDSIVSITETGVEEVFDLTVPGPHNFVANDIIV--------------------
1tueA           TDTKVAMLDDATTTCWTYFDTYMRNALDGN----------------------------------------
1l7lA           LICHDAFCGALVMK---IGNSGTIPVNTGLFRWVA------PNNVQGAITLIYNDVP-----GTYGNNSG
1qhdA1          YSPSREDNLQRVFTVA----SIRS----------------------------------------------
1uouA3          ----------------------------------------------------------------------
1odfA           EKSIGYASIDDFYLTHEDQLKLNEQFK--NNKLLQGRGLPGTHDMKLLQEVLNTIFNQDTVVLPKYDQFK
1yvuA2          --------------------------------------------------------------------TR
1puoA2          VANGNELLLDLSLTK--VNATEPERTAMKK-----IQDCYVENGISRVLDGLVMTTISSSKD--------
1e2hA           IYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEALTLIFDRHPIAALLCYPAARYL
1oa8A           -----------------------EDLKTEDFIQSAEISNDLKIDSST----VERIEDSHSPGVAVIQFAV
1zbsA1          -----------------------------------------LFDGREIKANV--SPLGYILGDEGSGAVL
1yj5A2          SSCQAALRQGKRVVIDNTNPDVPSRARYIQCAKDAGVPCRCFNFCATIEQARHNNRFREDPSHAPVSDXV
1l1oA           ----------------------------------------------------------------------
1dxeA           ----------------------------------------------------------------------
1jqjA2          ------------------------------------FTLPQATMKRLIEATQFSMGMLFETEGEELRTVA


                         +         .         .         .         .         *         .:210
query           GQKQRAVIARMFASDPDVFILDEPTTGMDAGSKNEFYELMHHSAHHHGKAVLMITHDPEEVKDYADRNIH
1sgwA           GTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKEKGIVIISSREELS----YCDVNEN
1b0uA           GQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQ-LAEEGKTMVVVTHEMGFARHVSSHVIF
1e69A           GEKALVGLALLFAKPSPFYVLDEVDSPLDDYNAERFKRLLKE--NSKHTQFIVITHNKIVM-EAADLLHG
1m3eA1          NKDGSIAIASKPREVREFNGQHFILEEAIRGDFALVKAWKAD--QAGNVTFRKSARNFNLPXCKAA----
1ex6A           KAIPELNARFLFIAPPSVEDLKKRLEGRGTETEESINKRLSAYAETGAHDKVIVNDDLDKAYKELKDFIF
1l7vC           GEWQRVRLAAVVLQAGQLLLLDEPXNSLDVAQQSALDKIL-SALCQQGLAIVXSSHDLNHTLRHAHR---
1q3hA           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVC--KLMANKTRILVTSKMEHLRKADKILI
1ji0A           GEQQXLAIGRALXSRPKLLXXDEPSLGLAPILVSEVFE-VIQKINQEGTTILLVEQNALGALKVAHY---
1pf4A1          GQRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDE--LQKNKTVLVIAHRL-STIEQADEILV
1khbA1          KEWSSEDGEPCAHPNSRFCTPASQCPIIDAAWESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVF---
1t06A           ELKMSAGWSWLLGNRKDNAFSESKISDMLEMVKDTIHHSPERTKSAMNNFLNTVAPLHEKAVEIAKEVGI
1e9rA           LALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFS
1qhlA           YHSLMARRLRSASDRSKFYRLIEASGGISSAITRSLRDYL------------------------------
1bgxT2          RAPTPEDFPRQLALIKELVDLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLSDRIHV
1mukA           QDVNTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLLPKDGRHLNTDIPPRMGWLRAILRFLGA-------
2yyeA2          LDNWKLILLSDPVTSGGLLFTINKE------KLEKIDETA-KELEVNYWIIGETIAENVLE---------
1ohcA1          DQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSYIPFRDAAYFYITLLDCFHAVKKAMQY------
1es6A2          IEVPETLVLKLTGGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASL-----------------
1f2t.1          GERFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMER-YLKKIPQVILVSHD-EELKDAADHVIR
1bmfA3          AYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAGDVSAY--IPTNVIS
1jjvA           QTAPYTLFVVPLLIENKLTALCDRILVVDVSPQTQLARSAN---FEQIQRIMNSQVSQQERLKWADDVIN
1f46A           LFKLMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDIIR-----------------------------
2iqhA1          SVAHKSCLPACVYGSAVASGYDFEREGYS-------LVGIDPFRLLQNSQVYSLIRPNENPAHKSQL---
1tljA           TNQKGVLVELRTGIRMVHLLRESNTERVDKDKIKTLVNVCNEVL-ARGKQKMNLLKD-------------
1fl9A           QTNLGKNIISAFS---------------------------------------------------------
1kgdA           VLRTAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDILQRT--YAHYFDLTIINNEIDETIRHLEEAVE
1nijA1          TFFSHEVLCQRYLLDGVIALVDAVHADEQMNQFTIAQSQV----GYADRILLTKTDVAGEAEKLHERLAR
1mjgM           KNYGEILVAKMKEEFPAIVDRVQVTIFTDEAKVKEYMEVAREYKERDDRMRGLTDETVDTFYS-------
2vgmA3          GE-KEVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDS-VESNGGKALVLSTLHSLGEELDQL---
1jalA1          TINTELALADLDSCERAIQRLQKRAKGGDKEAKFELSVMEKILPVLENAGMIRSVGLDKEELQAIKSYNF
1pv4A3          ARAYNTVVPAVLTGGVDANALHRPKRFFGAARNVEEGG------SLTIIATALIDTGSKXDEVIYEEFKG
2fggA1          AGRQXVGVGLARLDPA-----DEPVAQIGD--ELAIARAL----SDLANQLFALTSSDIEASTH------
1xbtA1          AILNLVPLAE------------------------------------------------------------
1grqA           GDLDVLW----VGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTH-KESIECAWAIAA
1g6oA           EAFIRLAAAR---NIKFESLIEGFKDLID---------XIVHINHHKQCDEFYI----------------
1ffhA2          RLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSAR
1c4oA1          AIYGLGDPREYRARNLVGFVLFPATHYLS-----------------------------------------
1iqrA2          TPRRRAWFLENV------RALREAYRARGGALWVLEGLPWEKVARRLKAKAVYALTSHTPYGRYRDG---
1mm8A           GAMQTV----KLAQEFPELLAIEDTTSLSYRHQVA--EELGKLGSIQDKSRGWWVHSVLLLEATTFR---
1urjA           EQRLASVMAGLESIVSMAVFDEPPTDISAWPLFEARANAVGAYLARAAGLVGAMVFSTNS----------
1zs3A1          DENEIVPSTTEEFLKYHKFITEDPKAKYWTDE-----DLLESFIVDFQAQNMFITRAIKLANKEEK----
3cddA1          AAKADVTDSEIGRYRPLIIVNEEVTAEGAAKRGQWERQRSIGKSNXAEYTVTGWRIPQTGKLWNINTLVP
1ak2A1          SIPDSLLIRRITGRLIHSDDNKKALKIRLEAYHTQTTPLVEYYSKRGIHSAIDASQTPDVVFASILAAFS
2v3jA1          LKVIKNPITDHLPTKCRKVTLSFDAPVIRVQDYIEKLD------DDESICVFVGAGKDNFADEYVDEKVG
1zp6A1          IERCLDRGGDSLSDPLVVADLHSQFADLGAFEHHVLPVSG-KDTDQALQSAINALQS-------------
1j1zA2          ERLSPA----ALLQRLNEIGGRHGVGRVDIVENRFVGMKSRGVYETPGGTILYHARRAVESLTLDREVLH
1t3wA           SLNHXFDSLLEL--RQEELIARERTHGLSNEERLELWTLN------------------------------
2gx8A1          KLDDKVRKVAVLGGDGNKYINQAKFKGADVYVTGDMYYHVAHDAMMLGLNIVDPGHNVEKKQGVQKQLQE
2qgmA1          KPFEDLKPLKKXIGNAQYVGLGENTHGSSEIFTXKFRLVKYLVTEXG-FTNFAXEEDWGNGLKLNEYIQT
2f9hA1          SNLQSIAHSTLIFADAPTDEDDVIRNGVY-------LTPHQLPKITIGTTIDYL----------------
2axpA1          KIDSILELYREVXSNAGLHTYSWDTGQWS-----------------------------------------
1e6cA           TGRPIAEEMEAVLREREALYQDVAHYVVDA----------------------------------------
1cr0A           AETDRLLAKLAYGLGCDVIILDHISI---RKMIDNLMTKLKGFAKSTGVVLVVICHDLRALRQLSDTIIA
1bs2A1          VERNASGITQEKWINADFSLLKEPAAKLLIRLLGQYPD-VLRNAIKTHEPTTVVTYLFKLTHQVSS----
1l3aA           GRSDEGRVRKVLKVEP---LPDGSGHFFNLSVQNKLINLDYIPVTKAEFAVLVSAFN-------------
1lw7A2          GKAHPFLDSXIKEYPFDVTILLKNNTEQK--QRQQFQQLL------------------------------
1dhyA1          GSAGDAALYRADQRAWRIAVQPGELDDLAYGLEVDDAAALERMADKLRQAGVAFTRGDEAL--MQQRKV-
2pa7A1          CLNGSCRVILDDGNIIQEITLDSPAVGLYVGPAVWH---EMHDFSSDCVMMVLASDYYDETDYIRQYDNF
1g6hA           GQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLE-LKAKGITFLIIEHRLDIVLNYIDHLYV
2gk3A1          LNRYDVIVISDIGSNTFLLQNETFYQLKIKPNALESIKEYV-----------------------------
1s9hA           GNSTTFEHQQPLQDRMFKFELTRRLDHDFGKTKQEVKDFFRWAKDH------------------------
1jb1A           GRNLAIIIEVAAXNFRAKSXGYDATKTFEKNLNHL-----------------------------------
1i1qA           AVLRAIATAH------------------------------------------------------------
1poiA           VRKTLDKVPDDKFKYIDNPFKPGEKVVAVPVPQVDVAIIHAQQASPDGTVRIGKFQDVDIAE-AAKYTI-
1n25A           RFVKQIDFRPKDYLKHCLERSEFLLEKRIIQSGIALLLMLIWYRPVAEFAQSIQSRIVEWKERLDKE---
1jbkA           EYRQYIEKDAALERRFQKVFVAEPSVEDT-----------------------------------------
1rkbA           TDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNV------------------------------
1cd5A           CVNHMWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELE-----------------------------
1viaA           KAKKLYNERLSKYEQKANFILNIENKNIDE----------------------------------------
1d8jA           GLKQKQWLMEALVNNPKIEVIDGKYAFKPKYN--------------------------------------
1afrA           IYTSFQERATFISHGNTARQAKEHGDIKLA-------QICGTIAADEKRHETAYTKIVEKLFEIDPDGTV
1dnpA2          SPRQAELINALNGLQIALAEKGIPLLFREVDDFVASVEIVKQVCAENSVTHLFYNYQYEVNERARDVEVE
1vplA           GMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQ-ASQEGLTILVSSHNMLEVEFLCDRIAL
1np6A           EEIAKIVLFRDGAGHRPEELVIDRHVIAVASDPLNLDVALLDINDVEGLADFVVEWMQKQ----------
1e3mA2          YFELTQLPEKXEGVANVHLDALEHGDTIAFXHSV----QDGAASKSYGLAVAALAGVPKEVIKRARQKLR
1em8A           -------------KNATFYLLDNDTTVDGLSAVEQLVCEIAAERWRSGKRVLIACEDEKQAYRLDEA---
1tmkA           MDLDWCLQPDVGLLKPDLTLFLSTQFGDERYETVKFQEKVKQ---------TFMKLLDKEIRKGDESITI
1d6jA           GEETGLPFVEVYVDVPVEAPYEAPANPEV-----------------------------------------
1atrA1          SQRQATKDAGTIAGLNVLRIINEPTAAAIA----------------------------------------
1sbxA           ERCETVLISCFVVGGEKRLCL---PQILNSVLRDFSLQQINAVCDELHIYCSRCTADQLEILKVXGILPF
2ancF1          TDLKTIIRAERLRMSRQKQRHDALISKLLA----------------------------------------
1esmA           LIYDVIPDGDKTVVQPDILILEGLNVLQSGXDYPHDPHHVFVSDFVDFSIYVDAPED-LLQTWYINRFLK
3cddA2          GETPHELLARLAK-QRGVLLTSDTFGNLVIT---------------------------------------
1gm5A1          KLQAFLDYVKEI------PNLPEARKRYRIQKSLEMIEKLRS----------------------------
1o7d.2          LGRKVDWMVRLPVSKHVYLVKDPGGKIVPSDVVTIPSSDSQE--LLFSALVPAVGFSIYSVS-QMPR---
1v47A1          ---PALEIGEDERLDLEN-LATGAFFPVKGFMTREEALSVAHEMRLPTGEVIPILLQFKPRVGPGNTVAL
1w1wA           GEKTVAALALLFAQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQ-FIVISLK-NTMFEKSDALVG
1f8xA           RQNKAYKEAMEALKENPTIDLENSYVPLDNQYKGIRVDEHPEYLHDKVWATATYNNDLNG-IKTNDIMLG
1ni3A1          AEIIHVEGDVD--PIRDLSIIVDELLIKDAEFVEKHLEGL------------------------------
1udwA           ADVVLFEGILAFYSQEVRDLFQMKLFVDTDADT-RLSRRVLRDISERGRDLEQILSQYITFVKPAFE---
1xl3C1          DEEQRQNLLQMCQNAIDMAIESE-----------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1g8yA           GLKRAAEGRRLMVLDTLRRFHIEEENASG--PMAQVIGRMEAIAADTGCSIVFLHHAVVDNIRWQSYLSS
1ii8.1          GLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMER-YLKKIPQVILVSHDEELK-DAADHVIR
1bccF           QWTKYEEDVPYLEPYLKEVI--------------------------------------------------
1vhhA           SERFKELTPNY---NPDIIFKDEENTGADRLMTQRCKDKLAISVMNQWPGVKLRVTEGWDEDGHHSEESL
1v37A           GALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHGG-VVRAVLRALGE
1iioA           SDAGQVLTADDFPKSAEEVADTIVN---------------------------------------------
1t9hA2          EIKDR-----------------------------------------------------------------
1yr6A1          FLFHEFGVRLMENLPYPLVVYISDPEILKKPNDYCFVRFFALLIDTIPALNKVDLLSEEEKERHRKYFED
1b77A2          ----------------------------------------------------------------------
1a4iA2          ---------------PAEILNGKEI---SAQIRARLKNQVTQLKEQVPGFTPRLAILQVGNRDDSNLYI-
1g8fA3          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1l7lA           SFSVN-----------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1uouA3          ----------------------------------LLAPADGTVELVRALPLALVLHELGALRLGVGAEL-
1odfA           GEGDRCPTGQKIKLPVDIFILEGWFLGFN-----------------------------------------
1yvuA2          DGKTVNAVAFTKIFNSKGELVRYYLTSYPAFGEKLTEKFSLLEKLGFKKGSKIVVHRDGRLYRD------
1puoA2          ----------------------------------------------------------------------
1e2hA           MGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAAIRRVYGLLANTVRY
1oa8A           GEHRAQVSVEVLVEYP-FFVFGQGWSSCCPERTSQLFDLPCS-KLSVGDVCISLTL--------------
1zbsA1          GRLFIGSLLKGQXPE---GLCEAFLQEYGLTSADIIESVYRK--PFPNRFLAGFSPFIAQHLDIPAVYSL
1yj5A2          XFSYRKQFEPPTLAEGFLEILEIPFRLQE-----------------------------------------
1l1oA           ----------------------------------------------------------------------
1dxeA           ------------------------------------IQHIFNRASAHGKPSGILAPVEADARRYLEWGAT
1jqjA2          TDGHRLAVCSMPIGQS----LPSHSVIVPRKGVIELMRMLDGGQIGSNNIRAHVGD--------------


                         .         .         .         +         .         .         .:280
query           LVRNQDSPWRCFNVHENGQEVGHx
1sgwA           L-----------------------
1b0uA           ------------------------
1e69A           VT----------------------
1m3eA1          ------------------------
1ex6A           AEK---------------------
1l7vC           ------------------------
1q3hA           L-----------------------
1ji0A           ------------------------
1pf4A1          V-----------------------
1khbA1          ------------------------
1t06A           VEVKR-------------------
1e9rA           IRSWLEDPNGGNLFI---------
1qhlA           ------------------------
1bgxT2          L-----------------------
1mukA           ------------------------
2yyeA2          ------------------------
1ohcA1          ------------------------
1es6A2          ------------------------
1f2t.1          I-----------------------
1bmfA3          I-----------------------
1jjvA           N-----------------------
1f46A           ------------------------
2iqhA1          ------------------------
1tljA           ------------------------
1fl9A           ------------------------
1kgdA           LV----------------------
1nijA1          I-----------------------
1mjgM           ------------------------
2vgmA3          ------------------------
1jalA1          ------------------------
1pv4A3          TGNXELHLSR--------------
2fggA1          ------------------------
1xbtA1          ------------------------
1grqA           HV----------------------
1g6oA           ------------------------
1ffhA2          HVTG--------------------
1c4oA1          ------------------------
1iqrA2          ------------------------
1mm8A           ------------------------
1urjA           ------------------------
1zs3A1          ------------------------
3cddA1          VIDE--------------------
1ak2A1          ------------------------
2v3jA1          L-----------------------
1zp6A1          ------------------------
1j1zA2          Q-----------------------
1t3wA           ------------------------
2gx8A1          K-----------------------
2qgmA1          GKGNPREFLKLLYPT---------
2f9hA1          ------------------------
2axpA1          ------------------------
1e6cA           ------------------------
1cr0A           LERNQ-------------------
1bs2A1          ------------------------
1l3aA           ------------------------
1lw7A2          ------------------------
1dhyA1          ------------------------
2pa7A1          K-----------------------
1g6hA           M-----------------------
2gk3A1          ------------------------
1s9hA           ------------------------
1jb1A           ------------------------
1i1qA           ------------------------
1poiA           ------------------------
1n25A           ------------------------
1jbkA           ------------------------
1rkbA           ------------------------
1cd5A           ------------------------
1viaA           ------------------------
1d8jA           ------------------------
1afrA           LMMRKKISMPAHLMY---------
1dnpA2          ------------------------
1vplA           ------------------------
1np6A           ------------------------
1e3mA2          ELESI-------------------
1em8A           ------------------------
1tmkA           V-----------------------
1d6jA           ------------------------
1atrA1          ------------------------
1sbxA           SAPS--------------------
2ancF1          ------------------------
1esmA           FFTDPDSYFHNYA-----------
3cddA2          ------------------------
1gm5A1          ------------------------
1o7d.2          ------------------------
1v47A1          L-----------------------
1w1wA           VYRQQQE-----------------
1f8xA           V-----------------------
1ni3A1          ------------------------
1udwA           ------------------------
1xl3C1          ------------------------
2vnuD1          ------------------------
1ckvA           ------------------------
1g8yA           M-----------------------
1ii8.1          I-----------------------
1bccF           ------------------------
1vhhA           ------------------------
1v37A           DGLVPPGSAVAVDW----------
1iioA           ------------------------
1t9hA2          ------------------------
1yr6A1          IDYLTARLKLDPSMQG--------
1b77A2          ------------------------
1a4iA2          -NVKLKAAEEIGIKATHIKLPRT-
1g8fA3          ------------------------
1mi8A           ------------------------
1tueA           ------------------------
1l7lA           ------------------------
1qhdA1          ------------------------
1uouA3          ------------------------
1odfA           ------------------------
1yvuA2          ------------------------
1puoA2          ------------------------
1e2hA           LQC---------------------
1oa8A           ------------------------
1zbsA1          VQNSFDDFLVRNVLR---------
1yj5A2          ------------------------
1l1oA           ------------------------
1dxeA           FV----------------------
1jqjA2          ------------------------