[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF55904.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1euhA.bssp"
#ERROR : Can't open dsspfile "1uzbA.bssp"
#ERROR : Can't open dsspfile "1ky8A.bssp"
#ERROR : Can't open dsspfile "1a4sA.bssp"
#ERROR : Can't open dsspfile "1ad3A.bssp"
#ERROR : Can't open dsspfile "1eyyA.bssp"
#ERROR : Can't open dsspfile "1o20A.bssp"
#ERROR : Can't open dsspfile "1k75A.bssp"
#ERROR : Can't open dsspfile "2p4xA1.bssp"
#ERROR : Can't open dsspfile "1xrhA.bssp"
#ERROR : Can't open dsspfile "1at3A.bssp"
#ERROR : Can't open dsspfile "1i6vC.bssp"
#ERROR : Can't open dsspfile "1efpA1.bssp"
#ERROR : Can't open dsspfile "1s7iA.bssp"
#ERROR : Can't open dsspfile "2qi2A2.bssp"
#ERROR : Can't open dsspfile "1vluA.bssp"
#ERROR : Can't open dsspfile "2b5dX1.bssp"

## Summary of PDB Search
:474
    e-111  72%  1euhA  [c.82.1.1] NADP DEPENDENT NON PHOSPHORYLATING
    e-105  29%  1uzbA  [c.82.1.1] 1-PYRROLINE-5-CARBOXYLATE DEHYDROGENASE
    e-100  35%  1ky8A  [c.82.1.1] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE
    3e-94  29%  1a4sA  [c.82.1.1] BETAINE ALDEHYDE DEHYDROGENASE
    1e-85  26%  1ad3A  [c.82.1.1] ALDEHYDE DEHYDROGENASE (CLASS 3)
    4e-81  19%  1eyyA  [c.82.1.1] ALDEHYDE DEHYDROGENASE
    2e-61  18%  1o20A  [c.82.1.1] GAMMA-GLUTAMYL PHOSPHATE REDUCTASE
    7e-59  12%  1k75A  [c.82.1.2] L-HISTIDINOL DEHYDROGENASE
    1e-38  12%  2p4xA1 [d.381.1.1] ATP12 ATPASE A:6 -- 238
    7e-30  12%  1xrhA  [c.122.1.1] UREIDOGLYCOLATE DEHYDROGENASE
    2e-26  11%  1at3A  [b.57.1.1] HERPES SIMPLEX VIRUS TYPE II PROTEASE
    7e-25  13%  1i6vC  [e.29.1.1] DNA-DIRECTED RNA POLYMERASE
    5e-21   8%  1efpA1 [c.26.2.3] PROTEIN (ELECTRON TRANSFER FLAVOPROTEIN) A:2 --
    4e-17  12%  1s7iA  [d.58.4.9] HYPOTHETICAL PROTEIN PA1349
    3e-13   9%  2qi2A2 [c.55.4.2] CELL DIVISION PROTEIN PELOTA RELATED PROTEIN
    6e-10  19%  1vluA  [c.82.1.1] GAMMA-GLUTAMYL PHOSPHATE REDUCTASE
    2e-05   9%  2b5dX1 [a.8.3.3] ALPHA-AMYLASE X:415 -- 528
:474

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTRYQNLVNGKWKSSEQEITIYSPINQEELGTVPAMTQTEXXXXXXXXXXXXXXXXXXXXIERAAYLHKT
1euhA           --QYKNYVNGEWKLSENEIKIYEPASGAELGSVPAMSTEEVDYVYASAKKAQPAWRALSYIERAAYLHKV
1uzbA           GRHYPLYIGGEWVDTKERMVSLNPSAPSEVGTTAKAGKAEAEAALEAAWKAFKTWKDWPQEDRSRLLLKA
1ky8A           VPVYPSYLAGEWGGSGQEIEVKSPIDLATIAKVISPSREEVERTLDVLFKRGRWSARDMPGERLAVLRKA
1a4sA           VTDDLNYWGGRRKDGATTEPVFEPATGRVLCQMVPCGAEEVDQAVQSAQAAYLKWSKMAGIERSRVMLEA
1ad3A           -------------------------------------------------------------FRIQQLEAL
1eyyA           --------------TDNVFYATNAFTGEALPLAPVHTEVEVNQAATAAAKVARDFRRLNNSKRASLLRTI
1o20A           ------------------------------------------------------------------DERR
1k75A           -------------------------------------------------------------QQRQLLXRP
2p4xA1          ----------------------------------------------------------------------
1xrhA           ----------------------------------------------------------------------
1at3A           ----------------------------------------------------------------------
1i6vC           ----------------------------------------------------------------------
1efpA1          ----------------------------------------------------------------------
1s7iA           ----------------------------------------------------------------------
2qi2A2          ----------------------------------------------------------------------
1vluA           -------------------------------------------------------------GRSDILYKI
2b5dX1          -------------------------------------------------------------VLNQMLRE-


                         .         .         *         .         .         .         .:140
query           AAILERDKEKIGTILAKEVAKGIKAAIGEVVRTADLIRYAAEEGXRITGQAMEGGGFEAASKNKLAVVRR
1euhA           ADILMRDKEKIGAILSKEVAKGYKSAVSEVVRTAEIINYAAEEGLRMEGEVLEGGSFEAASKKKIAVVRR
1uzbA           AALMRRRKRELEATLVYEVGKNWVEASADVAEAIDFIEYYARAALRYRYPAVEVVPYP----GEDNESFY
1ky8A           ADIIERNLDVFAEVLVMNAGKPKSAAVGEVKAAVDRLRLAELDLKKIGGDYIPGDWTYDT-LETEGLVRR
1a4sA           ARIIRERRDNIAKLEVINNGKTITEAEYDIDAAWQCIEYYAGLAPTLSGQHIQLPG------GAFAYTRR
1ad3A           QRMINENLKSISGALASDLGKNEWSYYEEVAHVLEELDTTIKELPDWAEDEPVAKTRQT--QQDDLYIHS
1eyyA           ASELEARSDDIIARAHLETALPEVRLTGEIARTANQLRLFADVVNSGSYHQATPNPTRAPLPKPDIRRQQ
1o20A           KEILEANRIDVEKARERGVKESLVDRLKRIDEXIKACETVIGLKDPVGEVID----SWVREDGLRIARVR
1k75A           AISASESITRTVNDILDNVKARGDEALREYSAKFDKTTVTALK--------VSAEEIAAASERLSDELKQ
2p4xA1          -------------------------------------------------------------------GWA
1xrhA           ----------------------------------------------------------------------
1at3A           --------------------------------------------------------------------RA
1i6vC           ----------------------TIAQANTPLEGDRIATDRVVARRRG-----EPVIVAPEEVEFMDVSPK
1efpA1          ----------------------------------------------------------------------
1s7iA           ----------------------------------------------------------------------
2qi2A2          ----------------------------------------------------------------------
1vluA           HDALKANAHAIEEANKIDLAVAKETGLADSL----LKRLDLFKGDKFEVXL-QGIKDVAELEDPVGKVKT
2b5dX1          --LFLAQSSDWAFIMTTRTSVQYAENRTKLHIKRFLNLYDQLVSGRIDEEMLRY---YEWTDAIFINFRV


                         +         .         .         .         .         *         .:210
query           EPVGIVLAIAPFNYPVNLSASKIAPALIAGNVVMFKPPTQGSISGLLLAKAFEEAGIPAGVFNTITGRGS
1euhA           EPVGLVLAISPFNYPVNLAGSKIAPALIAGNVIAFKPPTQGSISGLLLAEAFAEAGLPAGVFNTITGRGS
1uzbA           VPLGAGVVIAPWNFPVAIFTGMIVGPVAVGNTVIAKPAEDAVVVGAKVFEIFHEAGFPPGVVNFLPGVGE
1ky8A           EPLGVVAAITPFNYPLFDAVNKITYSFIYGNAVVVKPSISDPLPAAMAVKALLDAGFPPDAIALLNLPG-
1a4sA           EPLGVCAGILAWNYPFMIAAWKCAPALACGNAVVFKPSPMTPVTGVILAEIFHEAGVPVGLVNVVQGGA-
1ad3A           EPLGVVLVIGAWNYPFNLTIQPMVGAVAAGNAVILKPSEVSGHMADLLATLIPQY-MDQNLYLVVKGGVP
1eyyA           IALGPVAVFGASNFPLAFSAADTASALAAGCPVIVKGHTAHPGTSQIVAEALKQEQLPQAIFTLLQGNQR
1o20A           VPIGPIGIIYESRPNV--TVETTILALKSGNTILLRGGSDALNSNKAIVSALKETEIPESSVEFIENTRS
1k75A           AXAVAVKNIETFHTAQKLPPVDVETQPGVRCQQVTRPVAS-----VGLYIPGGSAPLFSTVLXLATP---
2p4xA1          VLLDERPLRTPGKQPLRLPTEALALAIWQAVQEVIDPNAM-PLTRSANSAIEKVAPQFDAVAAMLGDGTD
1xrhA           ----------------------------------------------------------------------
1at3A           VPIYLALYDSGDPGELALDPDTVRAALPPENPLPINVDHRARCEVGRVLAVVNDPRLSREERLLYLITNY
1i6vC           QVFSLNTNLIPFLEHDDANRALMGSNIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVVKVDGTRIAVRY
1efpA1          --------------------------------------------------------LVAEDALYGHRLAE
1s7iA           ----------------------------------------------------------------------
2qi2A2          ----------------------------------------------------------------------
1vluA           APVGVLLVI--FESRPEVIANITALSIKSGNAAILKGREXAKIVNDTIAQFQSETGVPVGSVQLIE---T
2b5dX1          MARDVI----------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           EIGDYIIEHKEVNFINFTGSTPIGERIGRLAGMRPIMLELGGKDAALVLEDADLEHAAKQIVAGAFSYSG
1euhA           EIGDYIVEHQAVNFINFTGSTGIGERIGKMAGMRPIMLELGGKDSAIVLEDADLELTAKNIIAGAFGYSG
1uzbA           EVGAYLVEHPRIRFINFTGSLEVGLKIYEAAGRLRAYVETGGKNAIIVDETADFDLAAEGVVVSAYGFQG
1ky8A           KEAEKIVADDRVAAVSFTGSTEVGERVVKVGGVKQYVMELGGGDPAIVLEDADLDLAADKIARGIYSYAG
1a4sA           ETGSLLCHHPNVAKVSFTGSVPTGKKVMEMSAVKHVTLELGGKSPLLIFKDCELENAVRGALMANFLTQG
1ad3A           ETTELL--KERFDHIMYTGSTAVGKIVMAAAALTPVTLELGGKSPCYVDKDCDLDVACRRIAWGKFMNSG
1eyyA           ALGQALVSHPEIKAVGFTGSVGGGRALFNLAHERPFYGELGAINPTFIFPSAMRAKADDQFVASMTMGCG
1o20A           LVLEXIRLREYLSLVIPRGGYGLISFVRD-NATVPVLETGVGNCHIFVDESADLKKAVPVIINAKTQRPG
1k75A           ------ASIAGCKKVVLCSPPPIADEILYAAQLCQDVFNVGGAQAIAALAFGTESVP----KVDKIFGPG
2p4xA1          LLSYRADAPEALVRAQAEGWDPLIDWAATELRLRITHGVIPVPQDPVVLLKLRAEVASLDPFGLTLVTLP
1xrhA           ----------------------------------------------------------------------
1at3A           LPSVSLSTKPDRTLFAHVALCAIGRRLGTIVTLDAAIAPFRHLDPA------------------------
1i6vC           EDG--RLVHPLRRYARSNQGTAFDQRPRVRVGQRVKKGDLLADGPASEEGFLALGQNVLVAIMPFDGYNF
1efpA1          PTAALIVGLAGDYSHIAAPATTDAKNVMPRVADTFERPIYAGNAIQVVKSKDAKKVFIRTASFDAAGEGG
1s7iA           ----------------------------------------------------------------------
2qi2A2          ------------------------------------------YVTVYTAVAMDEDEAQIFLIHPYQQVGT
1vluA           RVSDLLDQDEYIDLVVPRGSNALVRKIKDTTKI-PVLGHADGICSIYLDEDADLIKAKRISLD-----AK
2b5dX1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           QRCTAIKRVIVLESVADKLATLLQEEVSKLTVGDPFDNADITPVIDNASADFIWGLIEDAQEKEAQALTP
1euhA           QRCTAVKRVLVMESVADELVEKIREKVLALTIGNPEDDADITPLIDTKSADYVEGLINDANDKGATALTE
1uzbA           QKCSAASRLILTQGAYEPVLERVLKRAERLSVGPAEENPDLGPVVSAEQERKVLSYIEIGKNEGQLVLGG
1ky8A           QRCDAIKLVLAERPVYGKLVEEVAKRLSSLRVGDPRDTVDVGPLISPSAVDEMMAAIEDAVEKGGRVLAG
1a4sA           QVCTNGTRVFVQREIMPQFLEEVVKRTKAIVVGDPLLETRMGGLISKPQLDKVLGFVAQAKKEGARVLCG
1ad3A           QTCVAPDYILCDPSIQNQIVEKLKKSLKDFYGEDAKQSRDYGRIINDRHFQRVKGLIDNQKVAHGGTWDQ
1eyyA           QFCTKPGVVFALNTPETQAFIET-----AQSLIRQQSSTLLTPGIR---DSYQSQVVSRGSDDGID-VTF
1o20A           T-CNAAEKLLVHEKIAKEFLPVIVEELRKHGVEVRGCEKT------------------------------
1k75A           NAFVTEAKRQVSQRLDGAAIDXPAGPSEVLVIADSGATPDFV-------ASDLLSQAEHGPDSQVILLTP
2p4xA1          GSLILGLAVIRGRIDAPTALSRIDEEFQAERWGRD-----------------------------------
1xrhA           ------------SKISRETLHQLIENK-LCQAGLKREHATVAEVLVYADARGIHSHGAVRVEYYAERISK
1at3A           ----------------------------------------------------------------------
1i6vC           EDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPERITRDIPHLSEAALRDL--DEEGIVRIGAEVKPG
1efpA1          TAPVTETAAAADPGLSSWVADEVAE---------------------------------------------
1s7iA           -----------------------------CLIYFDEALAAVPAEELAAIVDECMTYSDQLGKAGHYIASH
2qi2A2          VYSGRSGKYYSEASYFDQIVNALKNYSNSIIILGPGFRDRFARYCAQRGVNVIGSFPANRTDSGA-----
1vluA           TNCNAXETLLINPKFSKWWEVLENLTLEG-----------------------------------------
2b5dX1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           IKREGNLLWPVLFDQVTKDMKVAWEEPFGPVLPIIRVASVEEAIAFANESEFGLQSSVFTNDFKKAFEIA
1euhA           IKREGNLICPILFDKVTTDMRLAWEEPFGPVLPIIRVTSVEEAIEISNKSEYGLQASIFTNDFPRAFGIA
1uzbA           KRLEGYFIAPTVFTEVPPKARIAQEEIFGPVLSVIRVKDFAEALEVANDTPYGLTGGVYSRKREHLEWAR
1ky8A           GRRGPTYVQPTLVADRVKDMVLYKREVFAPVASAVEVKDLDQAIELANGRPYGLDAAVFGRDVVKIRRAV
1a4sA           GEPNGYFMSPCVLDNCRDDMTCVKEEIFGPVMSVLPFDTEEEVLQRANNTTFGLASGVFTRDISRAHRVA
1ad3A           SS---RYIAPTILVDVDPQSPVMQEEIFGPVMPIVCVRSLEEAIQFINQREKPLALYVFSNNEKVIKKMI
1eyyA           SQAESPCVASALFVTSSENWPAWEEEIFGPQSLIVVCENVADMLSLSEMLAGSLTATIHATEEDYPQVSR
1o20A           --------REIVPDVVPATEDDWPTEYLDLIIAIKVVKNVDEAIEHIKKYSTGHSESILTENYSNAKKFV
1k75A           AADXARRVAEAVLAELPRAETARQALNASRL---IVTKDLAQCVEISNQY-GPEHLIIQTRNARELV--D
2p4xA1          ----------------------------------------------------------------------
1xrhA           GGTNREPEFRLEET-GPCSAILHADNAAGQVAA---KXGXEHAIKTAQQNGVAVVGISRXGHSGAISYVQ
1at3A           ----------------------------------------------------------------------
1i6vC           DILVGR-TSFKGEQEPSPEERLL-RSIFGEKARDVKDTSL------------------------------
1efpA1          ----------------------------------------------------------------------
1s7iA           ALQSVQLRHQGGRLAMTDGPFAETKEQLGGF-YLIEARDLNQALQIAAKIPPGRLGCVEVRPVKEW----
2qi2A2          ----------------------------------------------------------------------
1vluA           ----------------------------------------------------------------------
2b5dX1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           EKLEVGTVHINNKTQRGPDNFPFLGVKGSGAGVQGIKYSIEAMTNVKSIVFDVK
1euhA           EQLEVGTVHINNKTQRGTDNFPFLGAKKSGAGIQGVKYSIEAMTTVKSVVFDIK
1uzbA           REFHVGNLYFNRKITGALVVQPFGGFKLSGTNAKGALDYLRLFLEMKAVA----
1ky8A           RLLEVGAIYINDMPRHGIGYYPFGGRKKSGVFREGIGYAVEAVTAYKTIVFN--
1a4sA           ANLEAGTCYINTYS-ISPVEVPFGGYKMSGFGRENGQATVDYYSQLKTVIVE--
1ad3A           AETSSGGVTANDVIVHITVTLPFGGVGNSGMGAYHGKKSFETFSHRRSCLVK--
1eyyA           LEEIAGRLVFNGWPEVGYAMVHGGPYPASTHSASTSAEAIHRWLRPVAYQ----
1o20A           SEIDAAAVYVNAST-RFTDGGQFGFGAEIGISTQRFPVGLRELTTYKFVVL---
1k75A           SITSAGSVFLGDWS-PESAGDYASGTNTYGYTATCSSLGLADFQKRXTVQ----
2p4xA1          ------------------------------------------------------
1xrhA           QAARAGFIGISXCQSDPXV--VPFGGAEIYYGTNPLAFAAPGEGDEILTF----
1at3A           ------------------------------------------------------
1i6vC           ------------------------------------------------------
1efpA1          ------------------------------------------------------
1s7iA           ------------------------------------------------------
2qi2A2          ------------------------------------------------------
1vluA           ------------------------------------------------------
2b5dX1          ------------------------------------------------------