[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF55996.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2eyqA3.bssp"
#ERROR : Can't open dsspfile "1gm5A3.bssp"
#ERROR : Can't open dsspfile "1cevA.bssp"
#ERROR : Can't open dsspfile "1dzfA1.bssp"
#ERROR : Can't open dsspfile "2gnrA1.bssp"
#ERROR : Can't open dsspfile "2nwuA1.bssp"
#ERROR : Can't open dsspfile "2conA1.bssp"
#ERROR : Can't open dsspfile "2eyqA5.bssp"
#ERROR : Can't open dsspfile "1nltA3.bssp"
#ERROR : Can't open dsspfile "1a1vA1.bssp"
#ERROR : Can't open dsspfile "2dktA1.bssp"
#ERROR : Can't open dsspfile "1gkuB1.bssp"
#ERROR : Can't open dsspfile "2p6rA4.bssp"
#ERROR : Can't open dsspfile "1c7sA1.bssp"
#ERROR : Can't open dsspfile "1i3qL.bssp"
#ERROR : Can't open dsspfile "1yksA1.bssp"
#ERROR : Can't open dsspfile "1rifA.bssp"
#ERROR : Can't open dsspfile "2fwrA2.bssp"
#ERROR : Can't open dsspfile "2hf1A1.bssp"
#ERROR : Can't open dsspfile "1exkA.bssp"
#ERROR : Can't open dsspfile "1a6yA.bssp"
#ERROR : Can't open dsspfile "2p6rA3.bssp"
#ERROR : Can't open dsspfile "1qhh.1.bssp"
#ERROR : Can't open dsspfile "1imlA2.bssp"
#ERROR : Can't open dsspfile "1fp0A1.bssp"
#ERROR : Can't open dsspfile "2bhrA2.bssp"
#ERROR : Can't open dsspfile "2fwrA1.bssp"
#ERROR : Can't open dsspfile "1pjrA1.bssp"
#ERROR : Can't open dsspfile "1m6nA3.bssp"
#ERROR : Can't open dsspfile "1rybA.bssp"
#ERROR : Can't open dsspfile "1d4cA1.bssp"
#ERROR : Can't open dsspfile "1w36B1.bssp"
#ERROR : Can't open dsspfile "2yrbA1.bssp"
#ERROR : Can't open dsspfile "1hh5A.bssp"
#ERROR : Can't open dsspfile "1wp9A2.bssp"
#ERROR : Can't open dsspfile "1oftA.bssp"
#ERROR : Can't open dsspfile "2jneA1.bssp"
#ERROR : Can't open dsspfile "1oywA2.bssp"
#ERROR : Can't open dsspfile "1c4oA1.bssp"
#ERROR : Can't open dsspfile "1gm5A4.bssp"
#ERROR : Can't open dsspfile "1m2vB5.bssp"
#ERROR : Can't open dsspfile "1w36D1.bssp"
#ERROR : Can't open dsspfile "1t5iA.bssp"
#ERROR : Can't open dsspfile "2eyqA3.bssp"

## Summary of PDB Search
:798
    1e-43  29%  2eyqA3 [c.37.1.19] TRANSCRIPTION-REPAIR COUPLING FACTOR A:546 --
    3e-39  32%  1gm5A3 [c.37.1.19] RECG A:286 -- 549
    7e-38  14%  1cevA  [c.42.1.1] PROTEIN (ARGINASE)
    1e-36   9%  1dzfA1 [c.52.3.1] DNA-DIRECTED RNA POLYMERASES I, II, AND III 27
    2e-35   9%  2gnrA1 [b.40.4.15] CONSERVED HYPOTHETICAL PROTEIN A:8 -- 144
    2e-23  12%  2nwuA1 [d.77.1.2] UPF0201 PROTEIN SSO1042 A:3 -- 144
    2e-19  12%  2conA1 [g.41.15.1] NIN ONE BINDING PROTEIN A:8 -- 73
    9e-15  26%  2eyqA5 [c.37.1.19] TRANSCRIPTION-REPAIR COUPLING FACTOR A:779 --
    1e-12  18%  1nltA3 [g.54.1.1] MITOCHONDRIAL PROTEIN IMPORT PROTEIN MAS5 A:139
    5e-12  17%  1a1vA1 [c.37.1.14] PROTEIN (NS3 PROTEIN) A:190 -- 325
    4e-11  20%  2dktA1 [g.89.1.1] RING FINGER AND CHY ZINC FINGER DOMAIN- A:8 -- 81
    1e-10  18%  1gkuB1 [c.37.1.16] REVERSE GYRASE B:1 -- 250
    1e-10  15%  2p6rA4 [c.37.1.19] AFUHEL308 HELICASE A:203 -- 403
    1e-10   8%  1c7sA1 [b.1.18.2] BETA-N-ACETYLHEXOSAMINIDASE A:781 -- 885
    2e-10  20%  1i3qL  [g.41.9.2] DNA-DIRECTED RNA POLYMERASE II 7.7KD POLYPEPTIDE
    2e-10  22%  1yksA1 [c.37.1.14] GENOME POLYPROTEIN [CONTAINS: FLAVIVIRIN A:185
    2e-10  18%  1rifA  [c.37.1.23] DNA HELICASE UVSW
    5e-10  22%  2fwrA2 [c.37.1.19] DNA REPAIR PROTEIN RAD25 A:23 -- 256
    1e-09  16%  2hf1A1 [b.171.1.1] TETRAACYLDISACCHARIDE-1-P 4-KINASE A:2 -- 60
    1e-09  16%  1exkA  [g.54.1.1] DNAJ PROTEIN
    1e-09  17%  1a6yA  [g.39.1.2] ORPHAN NUCLEAR RECEPTOR NR1D1
    2e-09  20%  2p6rA3 [c.37.1.19] AFUHEL308 HELICASE A:1 -- 202
    3e-09  22%  1qhh.1 [c.37.1.19] PROTEIN (PCRA (SUBUNIT)) A:- -- - B:- -- - C:-
    3e-09  14%  1imlA2 [g.39.1.3] CYSTEINE RICH INTESTINAL PROTEIN A:29 -- 76
    6e-08  16%  1fp0A1 [g.50.1.2] KAP-1 COREPRESSOR A:19 -- 88
    1e-07  25%  2bhrA2 [c.37.1.14] RNA HELICASE A:178 -- 482
    2e-07  12%  2fwrA1 [c.37.1.19] DNA REPAIR PROTEIN RAD25 A:257 -- 456
    2e-07  20%  1pjrA1 [c.37.1.19] PCRA A:1 -- 318
    5e-07  18%  1m6nA3 [c.37.1.19] PREPROTEIN TRANSLOCASE SECA A:1 -- 226 A:349 --
    5e-07  12%  1rybA  [c.56.3.1] CRS2
    7e-07  15%  1d4cA1 [a.138.1.3] FLAVOCYTOCHROME C FUMARATE REDUCTASE A:1 -- 102
    2e-06  18%  1w36B1 [c.37.1.19] EXODEOXYRIBONUCLEASE V BETA CHAIN B:1 -- 485
    1e-05  13%  2yrbA1 [b.7.1.1] PROTEIN FANTOM A:596 -- 737
    3e-05  17%  1hh5A  [a.138.1.1] CYTOCHROME C7
    4e-05  19%  1wp9A2 [c.37.1.19] ATP-DEPENDENT RNA HELICASE, PUTATIVE A:201 --
    7e-05  15%  1oftA  [c.37.1.22] HYPOTHETICAL PROTEIN PA3008
    1e-04  23%  2jneA1 [g.41.18.1] HYPOTHETICAL PROTEIN YFGJ A:1 -- 71
    1e-04  26%  1oywA2 [c.37.1.19] ATP-DEPENDENT DNA HELICASE A:1 -- 206
    3e-04  10%  1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:2
    3e-04  22%  1gm5A4 [c.37.1.19] RECG A:550 -- 755
    5e-04  14%  1m2vB5 [g.41.10.1] PROTEIN TRANSPORT PROTEIN SEC24 B:216 -- 300
    9e-04  13%  1w36D1 [c.37.1.19] EXODEOXYRIBONUCLEASE V ALPHA CHAIN D:2 -- 360
    0.001  17%  1t5iA  [c.37.1.19] C_TERMINAL DOMAIN OF A PROBABLE ATP-DEPENDENT
    2e-04  21%  2eyqA3 [c.37.1.19] TRANSCRIPTION-REPAIR COUPLING FACTOR A:546 --(query 559->628)
:798

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2eyqA3          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
1dzfA1          ----------------------------------------------------------------------
2gnrA1          ----------------------------------------------------------------------
2nwuA1          ----------------------------------------------------------------------
2conA1          ----------------------------------------------------------------------
2eyqA5          ----------------------------------------------------------------------
1nltA3          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
2dktA1          ----------------------------------------------------------------------
1gkuB1          ----------------------------------------------------------------------
2p6rA4          ----------------------------------------------------------------------
1c7sA1          ----------------------------------------------------------------------
1i3qL           ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1rifA           ----------------------------------------------------------------------
2fwrA2          ----------------------------------------------------------------------
2hf1A1          ----------------------------------------------------------------------
1exkA           ----------------------------------------------------------------------
1a6yA           ----------------------------------------------------------------------
2p6rA3          ----------------------------------------------------------------------
1qhh.1          ----------------------------------------------------------------------
1imlA2          ----------------------------------------------------------------------
1fp0A1          ----------------------------------------------------------------------
2bhrA2          ----------------------------------------------------------------------
2fwrA1          ----------------------------------------------------------------------
1pjrA1          ----------------------------------------------------------------------
1m6nA3          ----------------------------------------------------------------------
1rybA           ----------------------------------------------------------------------
1d4cA1          ----------------------------------------------------------------------
1w36B1          ----------------------------------------------------------------------
2yrbA1          ----------------------------------------------------------------------
1hh5A           ----------------------------------------------------------------------
1wp9A2          ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
2jneA1          ----------------------------------------------------------------------
1oywA2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1gm5A4          ----------------------------------------------------------------------
1m2vB5          ----------------------------------------------------------------------
1w36D1          ----------------------------------------------------------------------
1t5iA           ----------------------------------------------------------------------
2eyqA3          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2eyqA3          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
1dzfA1          ----------------------------------------------------------------------
2gnrA1          ----------------------------------------------------------------------
2nwuA1          ----------------------------------------------------------------------
2conA1          ----------------------------------------------------------------------
2eyqA5          ----------------------------------------------------------------------
1nltA3          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
2dktA1          ----------------------------------------------------------------------
1gkuB1          ----------------------------------------------------------------------
2p6rA4          ----------------------------------------------------------------------
1c7sA1          ----------------------------------------------------------------------
1i3qL           ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1rifA           ----------------------------------------------------------------------
2fwrA2          ----------------------------------------------------------------------
2hf1A1          ----------------------------------------------------------------------
1exkA           ----------------------------------------------------------------------
1a6yA           ----------------------------------------------------------------------
2p6rA3          ----------------------------------------------------------------------
1qhh.1          ----------------------------------------------------------------------
1imlA2          ----------------------------------------------------------------------
1fp0A1          ----------------------------------------------------------------------
2bhrA2          ----------------------------------------------------------------------
2fwrA1          ----------------------------------------------------------------------
1pjrA1          ----------------------------------------------------------------------
1m6nA3          ----------------------------------------------------------------------
1rybA           ----------------------------------------------------------------------
1d4cA1          ----------------------------------------------------------------------
1w36B1          ----------------------------------------------------------------------
2yrbA1          ----------------------------------------------------------------------
1hh5A           ----------------------------------------------------------------------
1wp9A2          ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
2jneA1          ----------------------------------------------------------------------
1oywA2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1gm5A4          ----------------------------------------------------------------------
1m2vB5          ----------------------------------------------------------------------
1w36D1          ----------------------------------------------------------------------
1t5iA           ----------------------------------------------------------------------
2eyqA3          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2eyqA3          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
1dzfA1          ----------------------------------------------------------------------
2gnrA1          ----------------------------------------------------------------------
2nwuA1          ----------------------------------------------------------------------
2conA1          ----------------------------------------------------------------------
2eyqA5          ----------------------------------------------------------------------
1nltA3          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
2dktA1          ----------------------------------------------------------------------
1gkuB1          ----------------------------------------------------------------------
2p6rA4          ----------------------------------------------------------------------
1c7sA1          ----------------------------------------------------------------------
1i3qL           ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1rifA           ----------------------------------------------------------------------
2fwrA2          ----------------------------------------------------------------------
2hf1A1          ----------------------------------------------------------------------
1exkA           ----------------------------------------------------------------------
1a6yA           ----------------------------------------------------------------------
2p6rA3          ----------------------------------------------------------------------
1qhh.1          ----------------------------------------------------------------------
1imlA2          ----------------------------------------------------------------------
1fp0A1          ----------------------------------------------------------------------
2bhrA2          ----------------------------------------------------------------------
2fwrA1          ----------------------------------------------------------------------
1pjrA1          ----------------------------------------------------------------------
1m6nA3          ----------------------------------------------------------------------
1rybA           ----------------------------------------------------------------------
1d4cA1          ----------------------------------------------------------------------
1w36B1          ----------------------------------------------------------------------
2yrbA1          ----------------------------------------------------------------------
1hh5A           ----------------------------------------------------------------------
1wp9A2          ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
2jneA1          ----------------------------------------------------------------------
1oywA2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1gm5A4          ----------------------------------------------------------------------
1m2vB5          ----------------------------------------------------------------------
1w36D1          ----------------------------------------------------------------------
1t5iA           ----------------------------------------------------------------------
2eyqA3          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxVNFFVDQGAVTIVQKEVRRSAAYFEGIEASRPLELNPEQRQARDAVVSSIGSS
2eyqA3          --------------------------------------------CDSFPFETTPDQAQAINAVLSDMCQP
1gm5A3          -------------------LFVLQLAFQKIRKEREKHGGIPKKIEKSLPFKLTNAQKRAHQEIRNDMISE
1cevA           ------------------------------------------------------------DLGQTRRGVD
1dzfA1          ----------------------------------------------------------------------
2gnrA1          ----------------------------------------------------------------------
2nwuA1          ----------------------------------------------------------------------
2conA1          ----------------------------------------------------------------------
2eyqA5          ----------------------------------------------------------------------
1nltA3          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
2dktA1          ----------------------------------------------------------------------
1gkuB1          -----------------LCLFPEDF----LLKEFV--EFFRKCVG-----EPRAIQKMWAKRILRK----
2p6rA4          ----------------------------------------------------------------------
1c7sA1          ----------------------------------------------------------------------
1i3qL           ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1rifA           -------------------------------KDFDEWLSKLEIYSGNKRIEPHWYQKDAVFEGLV-----
2fwrA2          ---------------------------------VDNAADPIPTPYFDAEISLRDYQEKALERWLV-----
2hf1A1          ----------------------------------------------------------------------
1exkA           ----------------------------------------------------------------------
1a6yA           ----------------------------------------------------------------------
2p6rA3          --------------------------------------------------ELFPPQAEAVEKV-----FS
1qhh.1          -----------------------------------------NFLSEQLLAHLNKEQQEA----VRTTEG-
1imlA2          ----------------------------------------------------------------------
1fp0A1          ----------------------------------------------------------------------
2bhrA2          ----------------------------------------------------------------------
2fwrA1          ----------------------------------------------------------------------
1pjrA1          -----------------------------------------NFLSEQLLAHLNKEQQEAVRTTEGPL---
1m6nA3          -----------------------------------------------RVTGMFPFKVQLMGGVALHDGN-
1rybA           ----------------------------------------------------------------------
1d4cA1          ----------------------------------------------------------------------
1w36B1          ---------------------------------------------------DVAETLDPLRLPLQG----
2yrbA1          ----------------------------------------------STEYETIAACQLKFHEILEKSGRI
1hh5A           ----------------------------------------------------------------------
1wp9A2          ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
2jneA1          ----------------------------------------------------------------------
1oywA2          --------------------------------------------------QFRPGQEEIIDTVLS--GRD
1c4oA1          ----------------------------------------------------------------------
1gm5A4          ----------------------------------------------------------------------
1m2vB5          ----------------------------------------------------------------------
1w36D1          ------------------------------------------------VSDEINWQKVAAAVALTR----
1t5iA           ----------------------------------------------------------------------
2eyqA3          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           QPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEISLTPQMTERFIARFGDKVAILHSGLSNGEKY
2eyqA3          LADRLVCGDVGFGKTEVAMRAAFLAVDNHKQVAVLVPTTLLAQQHYDNFRDRFANRIEMISRFRSAKEQT
1gm5A3          KPNRLLQGDVGSGKTVVAQLAILDNYEAGFQTAFMVPTSILAIQHYRRTVESFSKHVALLIGATTPSEKE
1cevA           MGP---SAMRYAGVIERLERLHYDIEDLGDIPIGKAERLHEQGDSRLRNLKAVAEANEKLAAAVDQVVQR
1dzfA1          ----------------------------------------------------------------------
2gnrA1          ----------------------------------------------------------------------
2nwuA1          ----------------------------------------------------------------------
2conA1          ----------------------------------------------------------------------
2eyqA5          ----------------------------------------------------------------------
1nltA3          ----------------------------------------------------------------------
1a1vA1          ----HLHAPTGSGKSTKVPAAY---AAQGYKVLVLNPSVAATLGFGAYMSKAHGVDP-NIRTGVRTITTG
2dktA1          ----------------------------------------------------------------------
1gkuB1          -ESFAATAPTGVGKTSFGLAMSLFLALKGKRCYVIFPTSLLVIQAAEKYAEKAGVGTENLIGYYHGRIPK
2p6rA4          ----------------------------------------------------------------------
1c7sA1          ----------------------------------------------------------------------
1i3qL           ----------------------------------------------------------------------
1yksA1          ----VLDFHPGAGKTRRFLPQILAECARRRL-----RTLVLAPTRVVLSEMKEAFHGLDVKFHTQAFSAH
1rifA           NRRRILNLPTSAGRSLIQALLARYYLENYEGKIIIVPTTALTTQMADDFVDYRLFSHAMIKKIGGGASKD
2fwrA2          DKRGCIVLPTGSGKTHVAMAAIN---ELSTPTLIVVPTLALAEQWKERL-GIFGEEYVGEFSG-------
2hf1A1          ----------------------------------------------------------------------
1exkA           ----------------------------------------------------------------------
1a6yA           ----------------------------------------------------------------------
2p6rA3          GKNLLLAMPTAAGKTLLAEMAMVREAIKGGKSLYVVPLRALAGEKYESFKKWEKIGLRIGISTGDYESRD
1qhh.1          --PLLIMAGAGSGKTRVLTYLMAEKHVAPWNILAITFTNKAAREMRERVQSLLAEDVWISTFH-------
1imlA2          ----------------------------------------------------------------------
1fp0A1          ----------------------------------------------------------------------
2bhrA2          ----IMDLHPGAGKTKRYLAIVREAIKRGLRTLILAPTRVVAAEMEEALR---GLPIRYQREIVD-----
2fwrA1          ----------------------------------------------------------------------
1pjrA1          ----LIMAGAGSGKTRVLAYLMAEKHVAPWNILAITFTNKAAREMRERVQSLLAEDVWISTFH-------
1m6nA3          ----IAEMKTGEGKTLTSTLPVYLNALTGKGVHVVTVNEYLASRDAEKIFEFLGLTVGLNLNSMSKDEKR
1rybA           ----------------------------------------------------------------------
1d4cA1          ----------------------------------------------------------------------
1w36B1          --ERLIEASAGTGKTFTYLRLLLGAFPRPLTVLLVVFTEAATAELRGRIRSNIHELRIACLRETTDNPLY
2yrbA1          FCTASLIGTKGDIPNFGTVEYWF-----------------------------------------------
1hh5A           ----------------------------------------------------------------------
1wp9A2          ----------------------------------------------------------------------
1oftA           ----LSLSGLPGHCLTLLAPILRSEEQDARWLTLIAPPASLTHEW-LRRAGLNRERILLLQAKDNAAALA
2jneA1          ----------------------------------------------------------------------
1oywA2          ---CLVVXPTGGGKSLCYQ--IPALLLNGLTVV-VSPLISLXKDQVDQLQAN-GVAAACLNSTQTREQQL
1c4oA1          ----------------------------------AIAGLVEALRDGERFVTLLG----------ATGTGK
1gm5A4          ----------------------------------------------------------------------
1m2vB5          ----------------------------------------------------------------------
1w36D1          -RISVISGGPGTGKTTTVAKLLAALIQMADGERCRIRLAAPTGKAAARLTESLGKALRQLPLTDEQKKRI
1t5iA           ----------------------------------------------------------------------
2eyqA3          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           DEWRKVERGDAQVVVGARSAIFAPLKNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGS
2eyqA3          QILAEVAEGKIDILIGTHKLLQSKFKDLGLLIVDEEH----------RFGVRHKERIKAMRANVDILTLT
1gm5A3          KIKSGLRNGQIDVVIGTHALIQEDVKNLGLVIIDEQHRFEALMNKGKMVD--------------TLVM-S
1cevA           GRFPLVLGGDHSIAIGTLAGVAKHYERLGVIWYDAHGDVNTAETSPSGNHGMPLAASLGFGHPALTQIGG
1dzfA1          ----------------------------------------------------------------------
2gnrA1          ----------------------------------------------------------------------
2nwuA1          ----------------------------------------------------------------------
2conA1          ----------------------------------------------------------------------
2eyqA5          ----------------------------------------------------------------------
1nltA3          ----------------------------------------------------------------------
1a1vA1          SPITYSTYGKFLADGGXSGGAYDIIICDECHSTDATSILGIGT----------VLDQAETAGARLVVLAT
2dktA1          ----------------------------------------------------------------------
1gkuB1          REKENFMQRNFKIVITTTQFLSKHYRELGVDDVDAILKASKNVDKLLHLLGFHKTKSWVGEARGCLMVST
2p6rA4          ----------------------------------------------------------------------
1c7sA1          ----------------------------------------------------------------------
1i3qL           ----------------------------------------------------------------------
1yksA1          GSGREVIDAMCHATLTYRMLEPTRVVNWEVIIMDEAHFL-----DPASIAARGWAAHRARANESATILMT
1rifA           DKYKNDAPVVVGTWQTVVKQPKEWFSQFGMMMNDECHLATGKSIS---------SIISGLNNCMFKFGLS
2fwrA2          -RIKELKPLTVSTYDSAYVNAEKLGNRFMLLIFDEVHHLPAESYVQ---------IAQMSIAPFRLGL-T
2hf1A1          ----------------------------------------------------------------------
1exkA           ----------------------------------------------------------------------
1a6yA           ----------------------------------------------------------------------
2p6rA3          EGDCDIIVTTSEKADSLIRNRASWIKAVSCLVVDEIHLLDSEKRGATLEIL--VTKMRRMNKALRVIGLS
1qhh.1          ----------------------------------------------------------------------
1imlA2          ----------------------------------------------------------------------
1fp0A1          ----------------------------------------------------------------------
2bhrA2          ------LMCHA--TFTMRLLSPIRVPNYNLIIMDEAHFT----DPA-SIAARGYISTRVEMGEAAGIFMT
2fwrA1          ----------------------------------------------------------------------
1pjrA1          ----------------------------------------------------------------------
1m6nA3          EAYAADITYSTNNELGVLYKEQMVQRPLHFAVIDEVDSILIDEARTPLIISGQSMTLATITFQ-------
1rybA           ----------------------------------------------------------------------
1d4cA1          ----------------------------------------------------------------------
1w36B1          ERLLE-----------------------------------------------------------------
2yrbA1          ----------------------------------------------------------------------
1hh5A           ----------------------------------------------------------------------
1wp9A2          ----------------------------------------------------------------------
1oftA           LSCEALRLGRSHTVVSWLEPLAAQLGQAQSLNIRL-----------------------------------
2jneA1          ----------------------------------------------------------------------
1oywA2          EVXTGCRTGQIRLLYIALDNFLEHLAHWNPLAVDEAHCISWGHDFRPEY--AALGQLRQRF--PTLPFXA
1c4oA1          TVTMAKVIEALGRPALVLAPNKILAAQLAAEFRELFPENAVEYSYYDYYQPEAYVPGKDLYIEKDASINS
1gm5A4          ----------------------------------------------------------------------
1m2vB5          ----------------------------------------------------------------------
1w36D1          PEDAS-----------------------------------------------------------------
1t5iA           ----------------------------------------------------------------------
2eyqA3          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           ATPSLESRARAGKGVYQHLRLTQRANPLATIPEVQVIDFRDYIGQNETSNFTPPLLEAIQDRLVKKEQVV
2eyqA3          ATPIPRTLNMAMSGMR------------------------------------------------------
1gm5A3          ATPIPRSMALAFYGDLDVTVIDEM----------------------------------------------
1cevA           YSPKIKPEHVVLIGVRSLDEGEKKF---IREKGIKIYTMHE-----VDRLGMTRVMEETIAYLKERTDGV
1dzfA1          ----------------------------------------------------------------ERNISR
2gnrA1          ----------------------------------------------------------------------
2nwuA1          ----------------------------------------------------------------------
2conA1          ----------------------------------------------------------------------
2eyqA5          ----------------------------------------------------------------------
1nltA3          ----------------------------------------------------------------------
1a1vA1          ATP-------------------------------------------------------------------
2dktA1          ----------------------------------------------------------------------
1gkuB1          AT--------------------------------------------------------------------
2p6rA4          -----------------------------------------------------PLVEGVLCEGTLELFDG
1c7sA1          ----------------------------------------------------------------------
1i3qL           ----------------------------------------------------------------------
1yksA1          ATP-------------------------------------------------------------------
1rifA           GSLR------------------------------------------------------------------
2fwrA2          ATF-------------------------------------------------------------------
2hf1A1          ----------------------------------------------------------------------
1exkA           ----------------------------------------------------------------------
1a6yA           ----------------------------------------------------------------------
2p6rA3          ATAP------------------------------------------------------------------
1qhh.1          ----------------------------------------------------------------------
1imlA2          ----------------------------------------------------------------------
1fp0A1          ----------------------------------------------------------------------
2bhrA2          ATP-------------------------------------------------------------------
2fwrA1          ----------------------------------------------------------YEKREKVYKQFL
1pjrA1          ----------------------------------------------------------------------
1m6nA3          ----------------------------------------------------------------------
1rybA           ----------------------------------------------------------------------
1d4cA1          ----------------------------------------------------------------------
1w36B1          ----------------------------------------------------------------------
2yrbA1          ----------------------------------------------------------------------
1hh5A           ----------------------------------------------------------------------
1wp9A2          ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
2jneA1          ----------------------------------------------------------------------
1oywA2          LTATADDTTR--QDIVRLLGLN---DPLIQI---------------------------------------
1c4oA1          TTRSLLTR-RDVIVVASVSAIYGLGD----PREYRARNLVGFVLFPATHYLSPEGLEEILKEIEKERVRY
1gm5A4          ----------------------------------------------------------------------
1m2vB5          ----------------------------------------------------------------------
1w36D1          ----------------------------------------------------------------------
1t5iA           ----------------------------------------------------------------------
2eyqA3          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           LMLNRRGYSSFVMCRECGTVDTCPNCDISLTLHMDTKTMNCHYCGFSKDIPQVCPNCKSRSIRYYGTGTQ
2eyqA3          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
1dzfA1          LWRAFR--TVKEMVKDRGYFITQEEVELPLEMGRPQRKMMSFQANPTEESISKFPDMGSLWVEFCDEPSV
2gnrA1          ----KEGSRWYDVXEAERYEYTVGPAGEQFFNGLKQNKSKCSKCGRIFVPARYCEHCFVKIENYVNKDEA
2nwuA1          -----------------------------------------------------------VAEVRPSEDVN
2conA1          --------------------------------EARSYILRCHGCFKSDMNRVFCGHCGNKTLKKVSVTIN
2eyqA5          --------------------------------------------------------------------IQ
1nltA3          ---------AVKKCTSCNGIKFVTRQMGPMIQRFQTECDVCHGTGDIIDPKDRCKSCN-------GKKVE
1a1vA1          ----------------------------------------------------------------------
2dktA1          ---YDRACL--LKAPCCDKLYTCRLCHDTNEDHQLDRFVQCINCEKLQHAQQTCEDCSTL----------
1gkuB1          ----------------------------------------------------------------------
2p6rA4          AFSTSRRVKFEELVEECVAENGGVLVFES-----TRRGAEKTAVKLSAITAKYVENEGLEKAILE-ENEG
1c7sA1          --------------------------------------------------------------------FV
1i3qL           ------------------LKYICAECSSKLSLS-RTDAVRCKDCGHRILLKARTKRLVQFEAR-------
1yksA1          ----------------------------------------------------------------------
1rifA           ----------------------------------------------------------------------
2fwrA2          ----------------------------------------------------------------------
2hf1A1          --------------AKFLEILVCPLCKGPLVFDKSKDELICKGDRLAFPIKD------------------
1exkA           -------IPTLEECDVCGTQPQTCPTQVQMRQGFFAVQQTCPHCQGRTLIKDPCNKCHGHGR--------
1a6yA           -----------LLCKVCGGVLACEGCKGFFRRSIQQNIQYNENCSIVRINRNRCQQCRFKKCLSVGMSRD
2p6rA3          ----------------------------------------------------------------------
1qhh.1          ----------------------------------------------------------------------
1imlA2          ----------------------CEKCGKTLGHAEHEGKPYCNHPCYSAMFGPKGFGRGG-----------
1fp0A1          -----------VMCNQCEFCFHLDCHLPALQDVPG-EEWSCSLCHVLPDLKEEDVDLQACK---------
2bhrA2          ----------------------------------------------------------------------
2fwrA1          RARGITLRRAEDFNKIVMASGYDERAYEALRAWEEARRIAFNSKNKIRKLREILERHRKDKIIIFTRHNE
1pjrA1          ----------------------------------------------------------------------
1m6nA3          ----------------------------------------------------------------------
1rybA           -----------LVVKPQSYMNYSGEAIGPLAAYYQVPLRHILLIYDDTSLPNGVLRLQKKGGHGRHNGLQ
1d4cA1          -----HENGQCVSCHGDLKELAAPKDKVSPHKSHLIGEIACTSCHKGEKSVAYCDACHSFGDMPFGGKWE
1w36B1          ----------------------------------------------------------------------
2yrbA1          ----------------------------------------------------------------------
1hh5A           --------ADVVTYENKKEKLGCDACHEGTPAKIAIDKKACKTCHKSNNGPTKCGGCHIK----------
1wp9A2          ------------ASKEIFSDKRMKKAISLLVQAKEIGLDHPKMDKLKEIIREQLQRKQNSKIIVFTNYRE
1oftA           ----------------------------------------------------------------------
2jneA1          ---------------------HCPQCQHVLDQD--NGHARCRSCGEFIEMKALCPDCHQPLQVLKACGAV
1oywA2          ----------------------------------------------------------------------
1c4oA1          FEERGEVLYAQRLKERTLYDLEMLRVMGTCPGVENYARYFTGKAPGEPPYTLLDYFPEDFLVFLDESHVT
1gm5A4          ---------------------------------------------------------------FIVYPLI
1m2vB5          ----------------------CRRCRSYMNPFVTFRRWRCNFCRNDPKSRYDRNEIKCAVMEY------
1w36D1          ----------------------------------------------------------------------
1t5iA           --------------------------------------------------------------------SV
2eyqA3          --------------------------------------------------------------------AQ


                         .         .         .         *         .         .         .:630
query           KAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTA
2eyqA3          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
1dzfA1          KTMKTFVIHIQEKNFQTGIFVYQNNITPSMKLVPSIPPATIETFNEAALV--------------------
2gnrA1          YVDSYTIIYNDDEGN-KLAQPVYIALIRFPNIEGGLCYAEGNVKVGAKAKILSFQWPLRVKV--------
2nwuA1          KVLSAISNFFDFEKIIDILVLEARTLKSLLKFHRV---LRNERILDSARKYLXKGIEGNTIAFXIHKQAA
2conA1          DDGTLHMHFSRNPKVPRGLRYS------------------------------------------------
2eyqA5          KAAERLAELVPEARIAIGHGQMRERE--LERVMNDFHHQRFNVLVCTTIIETGIDIPTANTIIIERAD--
1nltA3          N---------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
2dktA1          ----------------------------------------------------------------------
1gkuB1          ----------------------------------------------------------------------
2p6rA4          EMSRKLAE-CVRKGAAFHHAGLLNGQ--RRVVEDAFRRGNIKVVVATPTLAAGVNLPARRVIVRSLYR--
1c7sA1          DTQALEKDWLRFANILGQRELAKLDK-----GGVAYRLPVPGARVAGGKLEANIALPGLGIEYSTDGGKQ
1i3qL           ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1rifA           ----------------------------------------------------------------------
2fwrA2          ----------------------------------------------------------------------
2hf1A1          ----------------------------------------------------------------------
1exkA           ----------------------------------------------------------------------
1a6yA           A---------------------------------------------------------------------
2p6rA3          ----------------------------------------------------------------------
1qhh.1          ----------------------------------------------------------------------
1imlA2          ----------------------------------------------------------------------
1fp0A1          ----------------------------------------------------------------------
2bhrA2          ----------------------------------------------------------------------
2fwrA1          LVYRISKVF----LIPAITHRTSREE--REEILEGFRTGRFRAIVSSQVLDEGIDVPDANVGVIMSGS--
1pjrA1          ----------------------------------------------------------------------
1m6nA3          ----------------------------------------------------------------------
1rybA           NVIEHLDGRREFPRLSIGIGSPPGKMDPRAFLLQKFSSEERVQI--DTALEQGVDAVRTL---VLKGE--
1d4cA1          R---------------------------------------------------------------------
1w36B1          ----------------------------------------------------------------------
2yrbA1          ----------------------------------------------------------------------
1hh5A           ----------------------------------------------------------------------
1wp9A2          TAKKIVNELVKDGIKAKRFVGQASKQREQKLILDEFARGEFNVLVATSVGEEGLDVPEVDLVVFYEPV--
1oftA           ----------------------------------------------------------------------
2jneA1          ----------------------------------------------------------------------
1oywA2          ----------------------------------------------------------------------
1c4oA1          VPQLQGMYRGDYARKKTLVDYGFRLPSALDNRPLRFEEFLERVSQVVSATPGPFELAHSGRV--------
1gm5A4          KSAVEMYEYLEVFKLGLMHGRLSQEE--KDRVMLEFAEGRYDILVSTTVIEVGIDVPRANVMVIENPE--
1m2vB5          ----------------------------------------------------------------------
1w36D1          ----------------------------------------------------------------------
1t5iA           QRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMP--
2eyqA3          QHYDNFRDRFANWPVRIEMISRFRSAKEQTQILAEVAEGKIDILIGTKLLQSDVKFKDLGLLIVDEEH--


                         .         +         .         .         .         .         *:700
query           LNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFxxxxxxxxxxxxxxxxxxxxxxxx
2eyqA3          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
1dzfA1          ----------------------------------------------------------------------
2gnrA1          ----------------------------------------------------------------------
2nwuA1          VGVLSFVAIKFYKEIVDWLAPKTAH----GVPLWDNPV--------------------------------
2conA1          ----------------------------------------------------------------------
2eyqA5          ---------HFGLAQLHQLRGRVGRSHHQAYAWLLTPHPK------------------------------
1nltA3          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
2dktA1          ----------------------------------------------------------------------
1gkuB1          ----------------------------------------------------------------------
2p6rA4          FDGYSKRIKVSEYKQMAGRAGRPGMDERGEAIIIVGKRDREIAVK-------------------------
1c7sA1          -WQRYDAKAKPAVSGDGKRYSRAEK---------------------------------------------
1i3qL           ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1rifA           ----------------------------------------------------------------------
2fwrA2          ----------------------------------------------------------------------
2hf1A1          ----------------------------------------------------------------------
1exkA           ----------------------------------------------------------------------
1a6yA           ----------------------------------------------------------------------
2p6rA3          ----------------------------------------------------------------------
1qhh.1          ----------------------------------------------------------------------
1imlA2          ----------------------------------------------------------------------
1fp0A1          ----------------------------------------------------------------------
2bhrA2          ----------------------------------------------------------------------
2fwrA1          ----------GSAREYIQRLGRILRPSKGKKAVLYELISRGTG---------------------------
1pjrA1          ----------------------------------------------------------------------
1m6nA3          ----------------------------------------------------------------------
1rybA           ----------------------------------------------------------------------
1d4cA1          ----------------------------------------------------------------------
1w36B1          ----------------------------------------------------------------------
2yrbA1          ----------------------------------------------------------------------
1hh5A           ----------------------------------------------------------------------
1wp9A2          ----------PSAIRSIQRRGRTGRHMPGRVIILMAKGTRDEAYYW------------------------
1oftA           ----------------------------------------------------------------------
2jneA1          ----------------------------------------------------------------------
1oywA2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1gm5A4          ------RFGLA---QLHQLRGRVGRGGQEAYCFL------------------------------------
1m2vB5          ----------------------------------------------------------------------
1w36D1          ----------------------------------------------------------------------
1t5iA           ----------EDSDTYLHRVARAGRFGTKGLAIT------------------------------------
2eyqA3          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2eyqA3          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
1dzfA1          ----------------------------------------------------------------------
2gnrA1          ----------------------------------------------------------------------
2nwuA1          ----------------------------------------------------------------------
2conA1          ----------------------------------------------------------------------
2eyqA5          ----------------------------------------------------------------------
1nltA3          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
2dktA1          ----------------------------------------------------------------------
1gkuB1          ----------------------------------------------------------------------
2p6rA4          ----------------------------------------------------------------------
1c7sA1          ----------------------------------------------------------------------
1i3qL           ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1rifA           ----------------------------------------------------------------------
2fwrA2          ----------------------------------------------------------------------
2hf1A1          ----------------------------------------------------------------------
1exkA           ----------------------------------------------------------------------
1a6yA           ----------------------------------------------------------------------
2p6rA3          ----------------------------------------------------------------------
1qhh.1          ----------------------------------------------------------------------
1imlA2          ----------------------------------------------------------------------
1fp0A1          ----------------------------------------------------------------------
2bhrA2          ----------------------------------------------------------------------
2fwrA1          ----------------------------------------------------------------------
1pjrA1          ----------------------------------------------------------------------
1m6nA3          ----------------------------------------------------------------------
1rybA           ----------------------------------------------------------------------
1d4cA1          ----------------------------------------------------------------------
1w36B1          ----------------------------------------------------------------------
2yrbA1          ----------------------------------------------------------------------
1hh5A           ----------------------------------------------------------------------
1wp9A2          ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
2jneA1          ----------------------------------------------------------------------
1oywA2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1gm5A4          ----------------------------------------------------------------------
1m2vB5          ----------------------------------------------------------------------
1w36D1          ----------------------------------------------------------------------
1t5iA           ----------------------------------------------------------------------
2eyqA3          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxx
2eyqA3          ----------------------------
1gm5A3          ----------------------------
1cevA           ----------------------------
1dzfA1          ----------------------------
2gnrA1          ----------------------------
2nwuA1          ----------------------------
2conA1          ----------------------------
2eyqA5          ----------------------------
1nltA3          ----------------------------
1a1vA1          ----------------------------
2dktA1          ----------------------------
1gkuB1          ----------------------------
2p6rA4          ----------------------------
1c7sA1          ----------------------------
1i3qL           ----------------------------
1yksA1          ----------------------------
1rifA           ----------------------------
2fwrA2          ----------------------------
2hf1A1          ----------------------------
1exkA           ----------------------------
1a6yA           ----------------------------
2p6rA3          ----------------------------
1qhh.1          ----------------------------
1imlA2          ----------------------------
1fp0A1          ----------------------------
2bhrA2          ----------------------------
2fwrA1          ----------------------------
1pjrA1          ----------------------------
1m6nA3          ----------------------------
1rybA           ----------------------------
1d4cA1          ----------------------------
1w36B1          ----------------------------
2yrbA1          ----------------------------
1hh5A           ----------------------------
1wp9A2          ----------------------------
1oftA           ----------------------------
2jneA1          ----------------------------
1oywA2          ----------------------------
1c4oA1          ----------------------------
1gm5A4          ----------------------------
1m2vB5          ----------------------------
1w36D1          ----------------------------
1t5iA           ----------------------------
2eyqA3          ----------------------------