[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF55997.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1d1lA.bssp"
#ERROR : Can't open dsspfile "1y9qA1.bssp"
#ERROR : Can't open dsspfile "1xwrA1.bssp"
#ERROR : Can't open dsspfile "1utxA.bssp"
#ERROR : Can't open dsspfile "1s4kA.bssp"
#ERROR : Can't open dsspfile "2auwA1.bssp"
#ERROR : Can't open dsspfile "2icpA1.bssp"
#ERROR : Can't open dsspfile "1x57A1.bssp"
#ERROR : Can't open dsspfile "1perL.bssp"
#ERROR : Can't open dsspfile "1lliA.bssp"
#ERROR : Can't open dsspfile "2ppxA1.bssp"
#ERROR : Can't open dsspfile "1b0nA2.bssp"
#ERROR : Can't open dsspfile "1y7yA1.bssp"
#ERROR : Can't open dsspfile "2o38A1.bssp"
#ERROR : Can't open dsspfile "2aw6A1.bssp"
#ERROR : Can't open dsspfile "1ic8A2.bssp"
#ERROR : Can't open dsspfile "2ao9A1.bssp"
#ERROR : Can't open dsspfile "2ox6A1.bssp"

## Summary of PDB Search
:53
    5e-08  29%  1d1lA  [a.35.1.2] LAMBDA CRO REPRESSOR
    1e-06  26%  1y9qA1 [a.35.1.8] TRANSCRIPTIONAL REGULATOR, HTH_3 FAMILY A:4 --
    1e-06  18%  1xwrA1 [a.35.1.9] REGULATORY PROTEIN CII A:2 -- 80
    3e-06  22%  1utxA  [a.35.1.3] CYLR2
    4e-06  20%  1s4kA  [a.35.1.6] PUTATIVE CYTOPLASMIC PROTEIN YDIL
    5e-06  15%  2auwA1 [a.35.1.10] HYPOTHETICAL PROTEIN NE0471 A:88 -- 154
    5e-06  20%  2icpA1 [a.35.1.3] ANTITOXIN HIGA A:8 -- 94
    6e-06  33%  1x57A1 [a.35.1.12] ENDOTHELIAL DIFFERENTIATION-RELATED FACTOR 1
    6e-06  29%  1perL  [a.35.1.2] PROTEIN (434 REPRESSOR)
    9e-06  18%  1lliA  [a.35.1.2] PROTEIN (LAMBDA REPRESSOR)
    1e-05  24%  2ppxA1 [a.35.1.3] UNCHARACTERIZED PROTEIN ATU1735 A:30 -- 91
    1e-05  24%  1b0nA2 [a.35.1.3] PROTEIN (SINR PROTEIN) A:1 -- 68
    3e-05  33%  1y7yA1 [a.35.1.3] C.AHDI A:5 -- 73
    5e-05  14%  2o38A1 [a.35.1.13] HYPOTHETICAL PROTEIN A:28 -- 116
    1e-04  24%  2aw6A1 [a.35.1.11] PRGX A:1 -- 69
    2e-04  22%  1ic8A2 [a.35.1.1] HEPATOCYTE NUCLEAR FACTOR 1-ALPHA A:87 -- 180
    3e-04  17%  2ao9A1 [a.4.1.17] PHAGE PROTEIN A:13 -- 132
    5e-04  17%  2ox6A1 [a.35.1.6] HYPOTHETICAL PROTEIN SO3848 A:5 -- 166
:53

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xNMINVCDVGKRIKELRISSNLTQDKIAEYLSLNQSMIAKMEKGERNITxxxx
1d1lA           --------MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIF----
1y9qA1          -------QIANQLKNLRKSRGLSLDATAQLTGVSKAXLGQIERGESSPT----
1xwrA1          --------LRIESALLNKIAMLGTEKTAEAVGVDKSQISRWKRDWI-------
1utxA           --------IINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPS----
1s4kA           --------NALELQALRRIFDXTIEECTIYIDNNSATWQRWEAGDIPIS----
2auwA1          --------SHEXFGDWXHRNNLSLTTAAEALGISRRXVSYYRTAHKIIP----
2icpA1          --------PGDIIQESLDELNVSLREFARAXEIAPSTASRLLTGKAALT----
1x57A1          -------EVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPN----
1perL           --------ISSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKT-------
1lliA           -QLEDARRLKAIYEKKKNELGLSQESLADKLGMGQSGIGALFNGI--------
2ppxA1          -----------RIKIIRRALKLTQEEFSARYHIPLGTLRDWEQGRSEPD----
1b0nA2          --------IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERNLQ-------
1y7yA1          -------KFGQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVS----
2o38A1          -ERQTKLRLAYALNAVIDRARLSQAAAAARLGINQPKVSALRNYK--------
2aw6A1          -------KIGSVLKQIRQELNYHQIDLYS-GIMSKSVYIKVEADSRPIS----
1ic8A2          --------VAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMK----
2ao9A1          -AKQIQAAYLLVENELMEEEKRTQDEMANELGINRTTLWEWRTKNQD------
2ox6A1          ----------IEMSYLRQSLSLSAAQVGQLTNHSEAEVLAWENAET-------