[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF56069.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1mtoA.bssp"
#ERROR : Can't open dsspfile "1kzhA.bssp"
#ERROR : Can't open dsspfile "1g8mA1.bssp"
#ERROR : Can't open dsspfile "1b0zA.bssp"
#ERROR : Can't open dsspfile "2jgrA1.bssp"
#ERROR : Can't open dsspfile "1bykA.bssp"
#ERROR : Can't open dsspfile "2hx0A1.bssp"
#ERROR : Can't open dsspfile "1b2vA.bssp"
#ERROR : Can't open dsspfile "1kyqA2.bssp"

## Summary of PDB Search
:335
    5e-91  62%  1mtoA  [c.89.1.1] 6-PHOSPHOFRUCTOKINASE
    2e-41  19%  1kzhA  [c.89.1.1] PHOSPHOFRUCTOKINASE
    3e-18  13%  1g8mA1 [c.24.1.3] AICAR TRANSFORMYLASE-IMP CYCLOHYDROLASE A:4 --
    9e-16  12%  1b0zA  [c.80.1.2] PROTEIN (PHOSPHOGLUCOSE ISOMERASE)
    7e-10  11%  2jgrA1 [e.52.1.2] YEGS A:4 -- 229
    2e-05  12%  1bykA  [c.93.1.1] PROTEIN (TREHALOSE OPERON REPRESSOR)
    3e-05  20%  2hx0A1 [d.290.1.3] PUTATIVE DNA-BINDING PROTEIN A:6 -- 141
    5e-05  12%  1b2vA  [d.35.1.1] PROTEIN (HEME-BINDING PROTEIN A)
    1e-04  16%  1kyqA2 [e.37.1.1] SIROHEME BIOSYNTHESIS PROTEIN MET8 A:151 -- 273
:335

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAGMVAGEIHPLDAASVGDIISRGGTFLHS
1mtoA           MKRIGVLTSGGDSPGMNAAIRSVVRKAIYHGVEVYGVYHGYAGLIAGNIKKLEVGDVGDIIHRGGTILYT
1kzhA           -LNIGIILSGGPAPGGHNVISGVFDAIKKFNPNSFGFKGGPLGLLENDKIELTESLINSYRNTGGFDIVS
1g8mA1          -RQQLALLSVSEKAGL----VEFARSLNALGLGLIASGGTATALRDAGLPVRD----------------V
1b0zA           ---------------------------------ISFDYSNALPFMQENELDYLSEMLHERKGPGSDFLGW
2jgrA1          ---------------------------------SLLILNGKST---------DNLPLREAIXLLREEGXT
1bykA           -KVVAIIVTRLDSLSENLAVQTMLPAFYEQGYDPIMMESQFSPQLVAEHLGVLKRRNID-----GVVLFG
2hx0A1          ----------------------------------------------------------------------
1b2vA           ----------------------------------------------------------------------
1kyqA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ARYPEFAQLEGQLKGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAIGLPGTIDNDIVGTDFTIGFD
1mtoA           ARCPEFKTEEGQKKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGFPCVGVPGTIDNDIPGTDFTIGFD
1kzhA           SGRTKIETEEHYNKALFVAKENNLNAIIIIGGDDSNTNAAILNGENIQVIGVPKTIDADLDHIEISFGFD
1g8mA1          SDLTGFPEXLGGRVKTLHPAVHAGILARNIPEDNA-----DXNKQDFSLVRV--VVCNLYPFVKTVSSPG
1b0zA           VDWPIRYDEFSRIKQAAERIRNHSDALVVIGIGGSYLGARAAIE----ALSHTFHNQMNDTTQIYFAGQN
2jgrA1          IHVRVTWEKGDAARYVEEARKFGVATVIAGGGDGTINEVSTALIDIPALGILPLGTANDFATSV------
1bykA           FTGITEEMLAHWQSSLVLLDAKGFASVCYDDEGAIKILMQRLYDQGHRNISLGVPHSDVTTGKRRHEAYL
2hx0A1          -------------------------------------------TGTFEVISLNGTLELTGEHLHLAVSDP
1b2vA           ----------------------------------VVHQVVYMSGDTGALETALNGILDDYG---LSVNST
1kyqA2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TAVTTAMDAIDKIRDTSSSHRRTFVIEVMGRNAGDIALWAGIATGADEIIIPEADFKMEDIVASIKAGYE
1mtoA           TALNTVIDAIDKIRDTATSHERTWVIEVMGRHAGDIALYSGLAGGAETILIPEADYDMNDVIARLKRGHE
1kzhA           SATKIYSELIGNLRDAMSTKKYWHFVKLMGRSASHVALECALKTHPNICIVSEEVLAIDEMVSVILKRSL
1g8mA1          VTVPEAVEKIDLLRAAAKNHARVTVVCDPADYSSVAKEXAASKDK-------------------------
1b0zA           ISSTYISHLLDVLEGIAFRIFRDYMEKKYGKEEARKRIYVTTDRGALKKLADQEGYETFVIPDNIGGRYS
2jgrA1          ----------------------------------------------------------------------
1bykA           AFCKAHKLHPVAALPGLAMK--------------------------------------------------
2hx0A1          YGV-------------------------------------------------------------------
1b2vA           FDQVAAATA-------------------------------------------------------------
1kyqA2          ------------------------------------------------------------------ANLE


                         .         .         .         +         .         .         .:280
query           CGKKHNIIVLAEGVMSAAEFGQKLKEAGDTSDLRVTELGHIQRGGSPTARDRVLASRMGAHAVKLLKEGI
1mtoA           RGKKHSIIIVAEGVGSGVDFGRQIQEATG-FETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGK
1kzhA           NGDNFGVVIVPEGLIEFIP---EVKSLMLELCDIFDKNEGEFKGLNIEKMKEIFVAKLSDYMKGVYLSLP
1g8mA1          ----------------------------------------------------------------------
1b0zA           VLTAVGLLPIAVAGLNIDRM--------------------------------------------------
2jgrA1          ----------------------------------------------------------------------
1bykA           ----------------------------------------------------------------------
2hx0A1          ----------------------------------------------------------------------
1b2vA           ----------------------------------------------------------------------
1kyqA2          IGDRLQILISTNGLVRDEIRNLFTQXGDLALEDAVVKLGELRRGIRLLAPDDKDVKYRXDWARRCTDLFG


                         .         *         .         .         .         .         +:350
query           GGVAVGIRNEKMVENPILGTAEEGALFSLTAEGKIVVNNPHKADIELSSLNKSLS
1mtoA           GGRCVGIQNNQLVDHDI----------------AEALANKHTIDQRMYALSKELS
1kzhA           LFIQFELIKSILERDPH--------------------------------------
1g8mA1          -------------------------------------------------------
1b0zA           -------------------------------------------------------
2jgrA1          -------------------------------------------------------
1bykA           -------------------------------------------------------
2hx0A1          -------------------------------------------------------
1b2vA           -------------------------------------------------------
1kyqA2          IQHCHNIDVKRLLDL--FKVXFQEQNCSLQ-------------------------