[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF56087.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1u0lA1.bssp"
#ERROR : Can't open dsspfile "1t9hA2.bssp"
#ERROR : Can't open dsspfile "1t9hA1.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"
#ERROR : Can't open dsspfile "1nijA1.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1ni3A1.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "1rkbA.bssp"
#ERROR : Can't open dsspfile "1viaA.bssp"
#ERROR : Can't open dsspfile "1h65A.bssp"
#ERROR : Can't open dsspfile "1xbtA1.bssp"
#ERROR : Can't open dsspfile "1lnzA2.bssp"
#ERROR : Can't open dsspfile "1mkyA1.bssp"
#ERROR : Can't open dsspfile "2ancF1.bssp"
#ERROR : Can't open dsspfile "2cxxA1.bssp"
#ERROR : Can't open dsspfile "1xzpA1.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "1zd9A1.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "1zp6A1.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "1w1wA.bssp"

## Summary of PDB Search
:292
    6e-13  29%  1u0lA1 [b.40.4.5] PROBABLE GTPASE ENGC A:3 -- 68
    2e-12  39%  1t9hA2 [c.37.1.8] PROBABLE GTPASE ENGC A:68 -- 298
    7e-09  55%  1t9hA1 [b.40.4.5] PROBABLE GTPASE ENGC A:1 -- 67
    9e-05  20%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
    1e-04  28%  1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223
    2e-04  32%  1q3hA  [c.37.1.12] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-04  15%  1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306
    2e-04  30%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
    2e-04  30%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
    2e-04  29%  1rkbA  [c.37.1.1] PROTEIN AD-004
    2e-04  54%  1viaA  [c.37.1.2] SHIKIMATE KINASE
    2e-04  25%  1h65A  [c.37.1.8] CHLOROPLAST OUTER ENVELOPE PROTEIN OEP34
    3e-04  28%  1xbtA1 [c.37.1.24] THYMIDINE KINASE, CYTOSOLIC A:18 -- 150
    3e-04  44%  1lnzA2 [c.37.1.8] SPO0B-ASSOCIATED GTP-BINDING PROTEIN A:158 -- 342
    3e-04  57%  1mkyA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGA A:2 -- 172
    4e-04  32%  2ancF1 [c.37.1.1] GUANYLATE KINASE F:3 -- 206
    5e-04  39%  2cxxA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGB A:2 -- 185
    5e-04  12%  1xzpA1 [a.24.25.1] PROBABLE TRNA MODIFICATION GTPASE TRME A:118 --
    5e-04  11%  1n25A  [c.37.1.20] LARGE T ANTIGEN
    6e-04  14%  1zd9A1 [c.37.1.8] ADP-RIBOSYLATION FACTOR-LIKE 10B A:18 -- 181
    6e-04  31%  1ckeA  [c.37.1.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    7e-04  26%  1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181
    8e-04  21%  1e2hA  [c.37.1.1] THYMIDINE KINASE
    0.001  16%  1w1wA  [c.37.1.12] STRUCTURAL MAINTENANCE OF CHROMOSOME 1
:292

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQGQIIKALAGFYYVESDGQVYQTRARGNFRKKGHTPYVGDWVDFSAEENSEGYILKIHERKNSLVRPPI
1u0lA1          RRGIVVSFHSNMVTVEDEGERILCKLRGKFRLQNLKIYVGDRVEYTPDETGSGVIENVLHRK--------
1t9hA2          --------------------------------------------------------------NELIRPPI
1t9hA1          -EGKIIKALSGFYYVLDEDKVIQCRGRGIFRKNKITPLVGDYVVYQAENDKEGYLMEIKER---------
1grqA           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1h65A           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1zd9A1          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VNIDQAVVIMSVKEPDFNSNLLDRFLVLLEHKGIHPIVYISKMDLLEDRGELDFYRQTYGDIGYDFVTSK
1u0lA1          ----------------------------------------------------------------------
1t9hA2          CNVDQAVLVFSAVQPSFSTALLDRFLVLVEANDIQPIICITKMDLIEDQDTEDTIQAYAEDYRNIGYDVY
1t9hA1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1ni3A1          ---------------------------------------------------------------------K
1lw7A2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1h65A           ---------------------------------------------------------------------K
1xbtA1          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1n25A           -----------------------------FGSTGSADIEEWMAGVAWLHCLLPKMDSVVYDFLKCM----
1zd9A1          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EELLSLLTGKVTVFMGQTGVGKSTLLNKLVPDLNLETGEISDSLGRGRHTTRAVSFYNLNGGKIADTPGF
1u0lA1          ----------------------------------------------------------------------
1t9hA2          ---------LTSSKDQDSLADIIPHFQDKTTVFAGQSGVGKSSLLNAISPTRHVELIHTSGGLVADTPGF
1t9hA1          ----------------------------------------------------------------------
1grqA           ------MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFG-----------------------------
1nijA1          --------IAVTLLTGFLGAGKTTLLRHILNEQHGYKIAV------------------------------
1q3hA           ---LNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGII------------------------------
1ni3A1          VQWGRPGNNLKTGIVGXPNVGKSTFFRAI---TKSVLGNPANYPYATIDEEAKVAVPDERFDWLCEAYKP
1lw7A2          --------AKTVAILGGESSGKSVLVNKLAAVFNTTSAWEY-----------------------------
1yr6A1          ----------IVVFVGTAGSGKTTLTGEFGRYLEDNYKVA------------------------------
1rkbA           -----LMLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDL---------------------------
1viaA           ---------KNIVFIGFXGSGKSTLARALAKDLDL-----------------------------------
1h65A           QEDVNSLT---ILVXGKGGVGKSSTVNSI---IGERVVSISPFQSEGPRPVXVSRSRAGFTLNIIDTPGL
1xbtA1          --------GQIQVILGPMFSGKSTELMRRVRRFQIAQYKC------------------------------
1lnzA2          ------------GLVGFPSVGKSTLLSVVS----------------------------------------
1mkyA1          --------ATV-LIVGRPNVGKSTLFNKLV----------------------------------------
2ancF1          --------GTLYIVSAPSGAGKSSLIQ-------------------------------------------
2cxxA1          --------ATI-IFAGRSNVGKSTLIYRLTGK--------------------------------------
1xzpA1          ------------RGQEIFERGSDSLITNL-------RQKQLLENVKGHLEDAIKSLKEGMPVDMASIDLE
1n25A           --VYNIPKKRYWLFKGPIDSGKTTLAAALLELCGGKALNVNLPLDRLNFELGVAIDQFLVVFEDVKGTGG
1zd9A1          ------------TLVGLQYSGKTTFVNVIASG---QFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRF
1ckeA           --------APVITIDGPSGAGKGTLCKAMAEALQWHSGAI------------------------------
1zp6A1          ------LGGNILLLSGHPGSGKSTIAEALANLPGVPKVHFH-----------------------------
1e2hA           --------LLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMT-----------------------------
1w1wA           ---VGFGESNFTSIIGPNGSGKSNMMD----AISFVLGVLKDLIYRGPQSAYVKAFYQKGNKLVELMRII


                         .         .         .         +         .         .         .:280
query           SSLDYEVSRAEDLNQAFPEIATVSRDCKFRTCTHTHEPSCAVKPAVEEGVIATFRFDNYLQFLSEIENRR
1u0lA1          ----------------------------------------------------------------------
1t9hA2          SSLEFTDIEEEELGYTFPDIREKSSSCKFRGCLHLKEPKCAVKQAVEDGELKQYRYDHYVEFMTEIKDRK
1t9hA1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1ni3A1          KSRVPAFLTVFDI---------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1h65A           IEGGYINDXALNIIKSFLLDKTIDVLL-------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1xzpA1          RALNLLD---------------------------------------------------------------
1n25A           ESRDLPSGQGINNLDNLRDYL------DGSVKVNLEKKHLNKRTQIFPPGIVTMNEYSVPKTLQARFVKQ
1zd9A1          RSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLL---------------------------------
1ckeA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1w1wA           SRNGDTSYKIDGKTVSYKDY--------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ETYxxxxxxxxx
1u0lA1          ------------
1t9hA2          PRY---------
1t9hA1          ------------
1grqA           ------------
1nijA1          ------------
1q3hA           ------------
1ni3A1          ------------
1lw7A2          ------------
1yr6A1          ------------
1rkbA           ------------
1viaA           ------------
1h65A           ------------
1xbtA1          ------------
1lnzA2          ------------
1mkyA1          ------------
2ancF1          ------------
2cxxA1          ------------
1xzpA1          ------------
1n25A           ------------
1zd9A1          ------------
1ckeA           ------------
1zp6A1          ------------
1e2hA           ------------
1w1wA           ------------