[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF56127.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cr3A1.bssp"
#ERROR : Can't open dsspfile "1un8A1.bssp"
#ERROR : Can't open dsspfile "3cr3C1.bssp"
#ERROR : Can't open dsspfile "1pszA.bssp"
#ERROR : Can't open dsspfile "1hwxA1.bssp"

## Summary of PDB Search
:555
    2e-42  19%  3cr3A1 [a.208.1.1] PTS-DEPENDENT DIHYDROXYACETONE KINASE, ADP- A:1
    1e-23  17%  1un8A1 [a.208.1.1] DIHYDROXYACETONE KINASE A:336 -- 550
    1e-07  14%  3cr3C1 [c.54.1.2] PTS-DEPENDENT DIHYDROXYACETONE KINASE, C:3 -- 123
    6e-04  10%  1pszA  [c.92.2.2] PROTEIN (SURFACE ANTIGEN PSAA)
    8e-04  22%  1hwxA1 [c.2.1.7] GLUTAMATE DEHYDROGENASE A:209 -- 501
:555

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxKITTSLFQEMVQAASTRLNKQAEYVNSLNVFPVPDGDTGTNMGMTIENGAKEVADKPASTVGEVASIL
3cr3A1          ---LTIDTTIEWLGKFNEKIQENKAYLSELDG-PIGDGDHGANXARGXSETXKALEVSNFGNVSEIFKKV
1un8A1          --PSANALVAGIVELVTATLSDLETHLNAL-DAKVGDGDTGSTFAAAAREIASLLHRQPLNNLATLFALI
3cr3C1          ----------------------------------------------------------------------
1pszA           ----------------------------------------------------------------------
1hwxA1          --------------------------------------------GMTPGFGDKTFA---VQGFGNVGLHS


                         .         .         *         .         .         .         .:140
query           AKGLLMGARGNSGVITSQLFRGFSQAIKDKDELTGQDLALAFQSGVEVAYKAVMKPVEGTILTVSRGAAI
3cr3A1          AXTLXSKVGGASGPLYGSAFLAXSKT-----AIETLDTSELIYAGLEAIQKGKAQVGEKTXVDIWSAFL-
1un8A1          GERLTVVMGGSSGVLMSIFFTAAGQKLEQGA-----NVVEALNTGLAQMKFYGADEGDRTMIDALQPALT
3cr3C1          ----------------------------------------------------------------------
1pszA           ----------------------------------------------------------------------
1hwxA1          MRYLHFGAK----CVAVGESDG---SIWNPDGIDPKELEDFKLQHGTILGFPKAKIYEGSILEVDCDILI


                         +         .         .         .         .         *         .:210
query           GAKKKAEQTDDTVEVMRAALEGAKTALAKTPDMLPVLKEVGVVDSGGQGLVFIYEGFLSALxxxxxxxxx
3cr3A1          ----------NDLQTDSASKDNLEKVVKASAGLLATKRSIGHIDPGTQSSAYLFETLLEVV---------
1un8A1          SLLAQPKNLQAAFDAAQAGAERTCLSSKANAE-----SLLGNMDPGAQRLAMVFKALAES----------
3cr3C1          ----------------------------------------------------------------------
1pszA           ----------------------------------------------------------------------
1hwxA1          PAASEKQLTKSNAPRVKAKIIAEGANGPTTPQADKIFLERNIM---------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cr3A1          ----------------------------------------------------------------------
1un8A1          ----------------------------------------------------------------------
3cr3C1          ----------------------------------------------------------------------
1pszA           ----------------------------------------------------------------------
1hwxA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQVEKEATQVIKSAEEKEYALIAVVAGKG
3cr3A1          ----------------------------------------------------------------------
1un8A1          ----------------------------------------------------------------------
3cr3C1          -----------------------------------------------------------YGIVIVSHSPE
1pszA           ------------------------------------------KLDKESKDKFNKIPAEKKLIVTSEGAFK
1hwxA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LADIFCSQGVDYVIEGGQTMNPSTEDFIKAVEQVNARNIIFLPNNKNXFMAAQSAAEVLEQPAVVVEART
3cr3A1          ----------------------------------------------------------------------
1un8A1          ----------------------------------------------------------------------
3cr3C1          IASGLKKKNISLTAIGGLENGESFDRVXNAIEENEADNLLTFFDLGSARXNLDLVSEXTDKELTIFNVPL
1pszA           YFSKAYGVPSAYIWEINTEEEGTPEQIKTLVEKLRQTKVPSLFVESSVDRPMKTVSQDTNIP-IYAQIFT
1hwxA1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           LPQGMTSLLAFDPSKSIEENQERMTAALSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cr3A1          ----------------------------------------------------------------------
1un8A1          ----------------------------------------------------------------------
3cr3C1          IEGAYTASALLEAGATFEAIKEQLEKXL------------------------------------------
1pszA           DSIAEQGKEGDSYYSMMKYNLDKIAEGLA-----------------------------------------
1hwxA1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cr3A1          -----------------------------------------------------------------
1un8A1          -----------------------------------------------------------------
3cr3C1          -----------------------------------------------------------------
1pszA           -----------------------------------------------------------------
1hwxA1          -----------------------------------------------------------------