[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF56181.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1brmA2.bssp"
#ERROR : Can't open dsspfile "2gyyA1.bssp"
#ERROR : Can't open dsspfile "2gyyA2.bssp"
#ERROR : Can't open dsspfile "2hjsA2.bssp"
#ERROR : Can't open dsspfile "1nvmB1.bssp"
#ERROR : Can't open dsspfile "1b7gO2.bssp"
#ERROR : Can't open dsspfile "1vknA1.bssp"
#ERROR : Can't open dsspfile "2hjsA1.bssp"
#ERROR : Can't open dsspfile "1brmA1.bssp"

## Summary of PDB Search
:358
    8e-55  26%  1brmA2 [d.81.1.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE A:134 -- 354
    5e-31  74%  2gyyA1 [c.2.1.3] ASPARTATE BETA-SEMIALDEHYDE DEHYDROGENASE A:2 --
    4e-25  91%  2gyyA2 [d.81.1.1] ASPARTATE BETA-SEMIALDEHYDE DEHYDROGENASE A:128
    2e-19  23%  2hjsA2 [d.81.1.1] USG-1 PROTEIN HOMOLOG A:130 -- 319
    4e-13  18%  1nvmB1 [c.2.1.3] ACETALDEHYDE DEHYDROGENASE (ACYLATING) B:1 -- 131
    5e-13  15%  1b7gO2 [d.81.1.1] PROTEIN (GLYCERALDEHYDE 3-PHOSPHATE O:139 -- 300
    2e-11  21%  1vknA1 [c.2.1.3] N-ACETYL-GAMMA-GLUTAMYL-PHOSPHATE REDUCTASE A:1 --
    1e-08  30%  2hjsA1 [c.2.1.3] USG-1 PROTEIN HOMOLOG A:3 -- 129 A:320 -- 336
    1e-04  11%  1brmA1 [c.2.1.3] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE A:1 -- 133
:358

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxQMIKMLEESTLPIDKIRYLASARSAGKSLKFKDQDXXXXXXXXXAFEGVDIALF
1brmA2          ----------------------------------------------------------------------
2gyyA1          ----------------QMIKMLEESTLPIDKIRYLAS----GKSLKFKDQDITIEETTETAFEGVDIALF
2gyyA2          ----------------------------------------------------------------------
2hjsA2          ----------------------------------------------------------------------
1nvmB1          ----------------------------------LARAQRMGVTTTYAGVEGLIKLPEFADID-FVFDAT
1b7gO2          ----------------------------------------------------------------------
1vknA1          ----------------ELVRLLKNH--PEAKITYLSSRTYAGKKLETLENSILSEFDPEKVSKNCDVLFT
2hjsA1          ----------------------------------LASAESAGQRXGFAESSLRVGDVDSFDFSSVGLAFF
1brmA1          --------------------------------------------------------------------CQ


                         .         .         *         .         .         .         .:140
query           SAGSSTSAXYAPYAVKAGVVVVDNTSYFRQNPDVPLVVPEVNAHALDAHNGIIACPNCSTIQMMVALEPV
1brmA2          --------------------------------------------------------NCTVSLMLMSLGGL
2gyyA1          SAGSSTSAKYAPYAVKAGVVVVDNTSYFRQNPDVPLVVPEVNAHALDAHNGIIACPNAAWNSVQIA-ETL
2gyyA2          ---------------------------------------------------------CSTIQMMVALEPV
2hjsA2          ---------------------------------------------------------CAVAELCEVLAPL
1nvmB1          SASAHVQNEALLRQAKPGIRLIDLTPAAI----GPYCVPVVNLEEHLGKLNMVTYAGNLDIMTSAALATA
1b7gO2          ---------------------------------------------------------CNTTALLRTICTV
1vknA1          ALPAGASYDLVREL--KGVKIIDLGADFRDDPGVVYGLPELHREEI-KNAQVVGNPGLVKGASGQAVQNX
2hjsA1          AAAAEVSRAHAERARAAGCSVIDLSGALEPSVAPPVXV--------------------------------
1brmA1          GGDYTNEIYPKLRESGWQGYWIDAASSLRMKDDAIIILDPVNQDVITDGL-NNGIRTFVGGAAEPLRRML


                         +         .         .         .         .         *         .:210
query           RQKWGLDRIIVSTYQAVSGAGMGAILETQRELREVLNDGVKPRDLHAEILPSGGDKKHYPIAFNALPQID
1brmA2          FANDLVDWVSVATYQAASGGGARHMRELLTQMGHLYGHVADELATPTTLTRSGEDNFGVPLAGSLIPWID
2gyyA1          HERGLVRPTAELKFE-------------------------------------------------------
2gyyA2          RQKWGLDRIIVSTYQAVSGAGMGAILETQRELREVLNDGVKPCDLHAEILPSGGDKKHYPIAFNALPQID
2hjsA2          LATLDCRQLNLTACLSVSSLGREGVKELARQTAELLNARPLEPRLF-----------DRQIAFNLLAQVG
1nvmB1          ----------------------------------------------------------------------
1b7gO2          NKVSKVEKVRATIVRRAADQK---------EVKKGPINSLVP---DPATVPSH----HAKDVNSVIRNLD
1vknA1          NIXFGLD---------------------------------------------------------------
2hjsA1          ----------------------------------------------------------------------
1brmA1          RQL-------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VFTDNDXXXXXXXXXXXXXXXXXDDSIAVSATCVRIPVLSAHSESVYIETKEVAPIEEVKAAIAAFPGAV
1brmA2          WKGQAE----------TNKILNTSSVIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAHAKVV
2gyyA1          ----------------------------------------------------------------------
2gyyA2          VFTDNDYTYEEMKMTKETKKIMEDDSIAVSATCVRIPVLSAHSESVYIETKEVAPIEEVKAAIAAFPGAV
2hjsA2          AVDAEGHSAIERRIFAEVQALLGERIGPLNVTCIQAPVFFGDSLSVTLQCAEPVDLAAVTRVLDATKGIE
1nvmB1          ----------------------------------------------------------------------
1b7gO2          I----------------------------ATMAVIAPTTLMHMHFINITLKDKVEKKDILSVLENTPRIV
1vknA1          ----------------------------------------------------------------------
2hjsA1          ----------------------------------------------------------------------
1brmA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LEDDVAHQIYPQAINAVGSRDTFVGRIRKDLDAEKGIHMWVVSDNLLKGxxxxxxxxxxxxxxxxxxxxx
1brmA2          PNDREITMRELTPAAVTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWG---------------------
2gyyA1          ----------------------------------------------------------------------
2gyyA2          LEDDVAHQIYPQAINAVGSRDTFVGRIRKDLDAEKGIHMWVVSDNLLKG---------------------
2hjsA2          WVGEGDYP--TVVGDALGQDETYVGRVRAGQADPCQVNLWIVSDNVRKG---------------------
1nvmB1          ----------------------------------------------------------------------
1b7gO2          LISSKYDAEATAELVEVA---RDLKRDRNDI---------------------------------------
1vknA1          ----------------------------------------------------------------------
2hjsA1          ----------------------------------------------------------------------
1brmA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxx
1brmA2          --------
2gyyA1          --------
2gyyA2          --------
2hjsA2          --------
1nvmB1          --------
1b7gO2          --------
1vknA1          --------
2hjsA1          --------
1brmA1          --------