[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF56217.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2hydA2.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "1pf4A1.bssp"
#ERROR : Can't open dsspfile "1m3eA1.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "1pf4A2.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1nijA1.bssp"
#ERROR : Can't open dsspfile "1poiA.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1ex6A.bssp"
#ERROR : Can't open dsspfile "2iqhA1.bssp"
#ERROR : Can't open dsspfile "1bmfA3.bssp"
#ERROR : Can't open dsspfile "1jalA1.bssp"
#ERROR : Can't open dsspfile "1mukA.bssp"
#ERROR : Can't open dsspfile "1yvuA2.bssp"
#ERROR : Can't open dsspfile "1t06A.bssp"
#ERROR : Can't open dsspfile "1khbA1.bssp"
#ERROR : Can't open dsspfile "1rkbA.bssp"
#ERROR : Can't open dsspfile "1qhdA1.bssp"
#ERROR : Can't open dsspfile "1urjA.bssp"
#ERROR : Can't open dsspfile "1jjvA.bssp"
#ERROR : Can't open dsspfile "1jqjA2.bssp"
#ERROR : Can't open dsspfile "1ffhA2.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"
#ERROR : Can't open dsspfile "1udwA.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "2gx8A1.bssp"
#ERROR : Can't open dsspfile "1bgxT2.bssp"
#ERROR : Can't open dsspfile "1xbtA1.bssp"
#ERROR : Can't open dsspfile "1kgdA.bssp"
#ERROR : Can't open dsspfile "1qhlA.bssp"
#ERROR : Can't open dsspfile "1pv4A3.bssp"
#ERROR : Can't open dsspfile "2yyeA2.bssp"
#ERROR : Can't open dsspfile "2gk3A1.bssp"
#ERROR : Can't open dsspfile "2v3jA1.bssp"
#ERROR : Can't open dsspfile "1mjgM.bssp"
#ERROR : Can't open dsspfile "1zp6A1.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "1ni3A1.bssp"
#ERROR : Can't open dsspfile "1ii8.1.bssp"
#ERROR : Can't open dsspfile "1t3wA.bssp"
#ERROR : Can't open dsspfile "1l7lA.bssp"
#ERROR : Can't open dsspfile "1o7d.2.bssp"
#ERROR : Can't open dsspfile "1i1qA.bssp"
#ERROR : Can't open dsspfile "2axpA1.bssp"
#ERROR : Can't open dsspfile "1f46A.bssp"
#ERROR : Can't open dsspfile "1zs3A1.bssp"
#ERROR : Can't open dsspfile "1zbsA1.bssp"
#ERROR : Can't open dsspfile "1bs2A1.bssp"
#ERROR : Can't open dsspfile "1viaA.bssp"
#ERROR : Can't open dsspfile "1iioA.bssp"
#ERROR : Can't open dsspfile "1jb1A.bssp"
#ERROR : Can't open dsspfile "1tmkA.bssp"
#ERROR : Can't open dsspfile "1dnpA2.bssp"
#ERROR : Can't open dsspfile "1q3tA.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "1cd5A.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1g6oA.bssp"
#ERROR : Can't open dsspfile "1tljA.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1j1zA2.bssp"
#ERROR : Can't open dsspfile "1pgsA2.bssp"
#ERROR : Can't open dsspfile "1c4oA1.bssp"
#ERROR : Can't open dsspfile "1vhhA.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "2f9hA1.bssp"
#ERROR : Can't open dsspfile "1s9hA.bssp"
#ERROR : Can't open dsspfile "1f8xA.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "2qgmA1.bssp"
#ERROR : Can't open dsspfile "1e3mA2.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1l1oA.bssp"
#ERROR : Can't open dsspfile "1fl9A.bssp"
#ERROR : Can't open dsspfile "1atrA1.bssp"
#ERROR : Can't open dsspfile "1es6A2.bssp"
#ERROR : Can't open dsspfile "1dhyA1.bssp"
#ERROR : Can't open dsspfile "1mm8A.bssp"
#ERROR : Can't open dsspfile "1ak2A1.bssp"
#ERROR : Can't open dsspfile "1v47A1.bssp"
#ERROR : Can't open dsspfile "1jbkA.bssp"
#ERROR : Can't open dsspfile "1sbxA.bssp"
#ERROR : Can't open dsspfile "1ohcA1.bssp"
#ERROR : Can't open dsspfile "1g8yA.bssp"
#ERROR : Can't open dsspfile "3cddA1.bssp"
#ERROR : Can't open dsspfile "2ancF1.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1jqjA3.bssp"
#ERROR : Can't open dsspfile "1np6A.bssp"
#ERROR : Can't open dsspfile "1l3aA.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "1f2t.1.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1esmA.bssp"
#ERROR : Can't open dsspfile "1a4iA2.bssp"
#ERROR : Can't open dsspfile "1odfA.bssp"
#ERROR : Can't open dsspfile "2fggA1.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "1mi8A.bssp"
#ERROR : Can't open dsspfile "1xzpA1.bssp"
#ERROR : Can't open dsspfile "1xl3C1.bssp"
#ERROR : Can't open dsspfile "2je6I3.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "1tueA.bssp"
#ERROR : Can't open dsspfile "2vgmA3.bssp"
#ERROR : Can't open dsspfile "1uouA3.bssp"
#ERROR : Can't open dsspfile "2pa7A1.bssp"
#ERROR : Can't open dsspfile "1g8fA3.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "1gm5A1.bssp"
#ERROR : Can't open dsspfile "1em8A.bssp"
#ERROR : Can't open dsspfile "3cddA2.bssp"
#ERROR : Can't open dsspfile "1ovmA2.bssp"
#ERROR : Can't open dsspfile "1yj5A2.bssp"
#ERROR : Can't open dsspfile "1g31A.bssp"
#ERROR : Can't open dsspfile "1heiB1.bssp"
#ERROR : Can't open dsspfile "2gtlM1.bssp"
#ERROR : Can't open dsspfile "1oy5A.bssp"
#ERROR : Can't open dsspfile "1t9hA2.bssp"
#ERROR : Can't open dsspfile "1w1wA.bssp"
#ERROR : Can't open dsspfile "1b77A2.bssp"
#ERROR : Can't open dsspfile "1mkyA1.bssp"
#ERROR : Can't open dsspfile "2vnuD1.bssp"
#ERROR : Can't open dsspfile "1p5zB.bssp"
#ERROR : Can't open dsspfile "1gvnB.bssp"
#ERROR : Can't open dsspfile "1do0A.bssp"
#ERROR : Can't open dsspfile "2gujA1.bssp"
#ERROR : Can't open dsspfile "1dwmA.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"

## Summary of PDB Search
:581
    4e-58  22%  2hydA2 [f.37.1.1] ABC TRANSPORTER HOMOLOG A:1 -- 323
    3e-37  24%  1q3hA  [c.37.1.12] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-36  21%  1b0uA  [c.37.1.12] HISTIDINE PERMEASE
    2e-35  14%  1e69A  [c.37.1.12] CHROMOSOME SEGREGATION SMC PROTEIN
    2e-35  42%  1pf4A1 [c.37.1.12] TRANSPORT ATP-BINDING PROTEIN MSBA A:321 -- 564
    2e-34  13%  1m3eA1 [c.124.1.2] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
    8e-33  24%  1l7vC  [c.37.1.12] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    8e-33  16%  1pf4A2 [f.37.1.1] TRANSPORT ATP-BINDING PROTEIN MSBA A:10 -- 320
    2e-32  20%  1sgwA  [c.37.1.12] PUTATIVE ABC TRANSPORTER
    6e-29  11%  1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223
    7e-29  12%  1poiA  [c.124.1.2] GLUTACONATE COENZYME A-TRANSFERASE
    2e-28  23%  1ji0A  [c.37.1.12] ABC TRANSPORTER
    4e-28  14%  1ex6A  [c.37.1.1] GUANYLATE KINASE
    1e-27   9%  2iqhA1 [e.75.1.1] NUCLEOCAPSID PROTEIN A:21 -- 489
    1e-26   9%  1bmfA3 [c.37.1.11] BOVINE MITOCHONDRIAL F1-ATPASE A:95 -- 379
    2e-26  10%  1jalA1 [c.37.1.8] YCHF PROTEIN A:1 -- 278
    2e-26   9%  1mukA  [e.8.1.4] MINOR CORE PROTEIN LAMBDA 3
    3e-26  17%  1yvuA2 [c.55.3.10] HYPOTHETICAL PROTEIN AQ_1447 A:315 -- 706
    4e-26   8%  1t06A  [a.118.1.17] HYPOTHETICAL PROTEIN
    2e-25   8%  1khbA1 [c.91.1.1] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    1e-24  13%  1rkbA  [c.37.1.1] PROTEIN AD-004
    1e-22   9%  1qhdA1 [a.115.1.2] VIRAL CAPSID VP6 A:1 -- 148 A:333 -- 397
    2e-22  12%  1urjA  [e.58.1.1] MAJOR DNA-BINDING PROTEIN
    4e-22  13%  1jjvA  [c.37.1.1] DEPHOSPHO-COA KINASE
    1e-21  17%  1jqjA2 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:123 -- 244
    3e-21  15%  1ffhA2 [c.37.1.10] FFH A:89 -- 295
    4e-21  10%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
    7e-21  10%  1udwA  [c.37.1.6] URIDINE-CYTIDINE KINASE 2
    7e-21  12%  1e9rA  [c.37.1.11] CONJUGAL TRANSFER PROTEIN TRWB
    2e-20   8%  2gx8A1 [c.135.1.1] NIF3-RELATED PROTEIN A:4 -- 373
    3e-20  12%  1bgxT2 [c.120.1.2] TAQ DNA POLYMERASE T:1 -- 173
    3e-20  10%  1xbtA1 [c.37.1.24] THYMIDINE KINASE, CYTOSOLIC A:18 -- 150
    6e-20   7%  1kgdA  [c.37.1.1] PERIPHERAL PLASMA MEMBRANE CASK
    1e-19  13%  1qhlA  [c.37.1.12] PROTEIN (CELL DIVISION PROTEIN MUKB)
    1e-19  12%  1pv4A3 [c.37.1.11] TRANSCRIPTION TERMINATION FACTOR RHO A:129 --
    3e-19  15%  2yyeA2 [d.139.1.1] SELENIDE, WATER DIKINASE A:155 -- 336
    4e-19   4%  2gk3A1 [c.23.16.9] PUTATIVE CYTOPLASMIC PROTEIN A:8 -- 253
    7e-19   9%  2v3jA1 [c.116.1.6] ESSENTIAL FOR MITOTIC GROWTH 1 A:23 -- 251
    3e-18   9%  1mjgM  [e.26.1.3] CARBON MONOXIDE DEHYDROGENASE ALPHA SUBUNIT
    3e-18  13%  1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181
    2e-17  11%  1n25A  [c.37.1.20] LARGE T ANTIGEN
    3e-17  11%  1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306
    4e-17  16%  1ii8.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    4e-17   8%  1t3wA  [a.236.1.1] DNA PRIMASE
    6e-17  11%  1l7lA  [b.18.1.16] PA-I GALACTOPHILIC LECTIN
    1e-16  13%  1o7d.2 [b.30.5.6] LYSOSOMAL ALPHA-MANNOSIDASE C:488 -- 585 D:603 --
    1e-16   9%  1i1qA  [d.161.1.1] ANTHRANILATE SYNTHASE COMPONENT I
    1e-16  10%  2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165
    3e-16  11%  1f46A  [d.129.4.1] CELL DIVISION PROTEIN ZIPA
    3e-16  12%  1zs3A1 [a.25.1.1] LACTOCOCCUS LACTIS MG1363 DPSA A:3 -- 173
    5e-16   8%  1zbsA1 [c.55.1.5] HYPOTHETICAL PROTEIN PG1100 A:108 -- 283
    8e-16  10%  1bs2A1 [a.27.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:484 -- 607
    1e-15  11%  1viaA  [c.37.1.2] SHIKIMATE KINASE
    1e-15  13%  1iioA  [a.39.4.1] CONSERVED HYPOTHETICAL PROTEIN MTH865
    1e-15  10%  1jb1A  [c.91.1.2] HPRK PROTEIN
    2e-15   8%  1tmkA  [c.37.1.1] THYMIDYLATE KINASE
    2e-15   7%  1dnpA2 [c.28.1.1] DNA PHOTOLYASE A:1 -- 200
    2e-15  13%  1q3tA  [c.37.1.1] CYTIDYLATE KINASE
    2e-15  14%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
    2e-15  12%  1cd5A  [c.124.1.1] PROTEIN (GLUCOSAMINE 6-PHOSPHATE DEAMINASE)
    2e-15  14%  1e6cA  [c.37.1.2] SHIKIMATE KINASE
    3e-15  16%  1g6oA  [c.37.1.11] CAG-ALPHA
    3e-15   8%  1tljA  [d.282.1.1] HYPOTHETICAL UPF0130 PROTEIN SSO0622
    4e-15  19%  1vplA  [c.37.1.12] ABC TRANSPORTER, ATP-BINDING PROTEIN
    4e-15   9%  1j1zA2 [d.210.1.1] ARGININOSUCCINATE SYNTHETASE A:171 -- 395
    4e-15  10%  1pgsA2 [b.121.1.1] PEPTIDE-N(4)-(N-ACETYL-BETA-D-GLUCOSAMINYL)
    5e-15   9%  1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:2
    6e-15  11%  1vhhA  [d.65.1.2] SONIC HEDGEHOG
    8e-15  12%  1d6jA  [c.37.1.4] ADENOSINE-5'PHOSPHOSULFATE KINASE
    1e-14  12%  2f9hA1 [b.161.1.1] PTS SYSTEM, IIA COMPONENT A:3 -- 123
    1e-14  10%  1s9hA  [c.37.1.20] REP 40 PROTEIN
    2e-14  15%  1f8xA  [c.23.14.1] NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE
    3e-14  10%  1ckvA  [d.137.1.1] PROTEIN (PROTEIN B)
    3e-14   4%  2qgmA1 [c.150.1.3] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN A:33 -- 445
    4e-14  11%  1e3mA2 [c.37.1.12] DNA MISMATCH REPAIR PROTEIN MUTS A:567 -- 800
    5e-14   6%  1afrA  [a.25.1.2] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    2e-13  14%  1l1oA  [b.40.4.3] REPLICATION PROTEIN A 14 KDA SUBUNIT
    2e-13  11%  1fl9A  [c.37.1.18] HYPOTHETICAL PROTEIN HI0065
    3e-13   8%  1atrA1 [c.55.1.1] HEAT-SHOCK COGNATE 70 KD PROTEIN A:2 -- 188
    6e-13  12%  1es6A2 [b.31.1.1] MATRIX PROTEIN VP40 A:201 -- 321
    6e-13  11%  1dhyA1 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:1 -- 132
    6e-13  12%  1mm8A  [c.55.3.4] TN5 TRANSPOSASE
    7e-13  12%  1ak2A1 [c.37.1.1] ADENYLATE KINASE ISOENZYME-2 A:14 -- 146 A:177 --
    7e-13  10%  1v47A1 [b.122.1.3] ATP SULFURYLASE A:4 -- 135
    7e-13  14%  1jbkA  [c.37.1.20] CLPB PROTEIN
    9e-13  15%  1sbxA  [a.6.1.4] SKI ONCOGENE
    1e-12  13%  1ohcA1 [c.45.1.1] CDC14B2 PHOSPHATASE A:42 -- 198
    1e-12  12%  1g8yA  [c.37.1.11] REGULATORY PROTEIN REPA
    2e-12  10%  3cddA1 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:181 -- 348
    2e-12  11%  2ancF1 [c.37.1.1] GUANYLATE KINASE F:3 -- 206
    4e-12  16%  1ckeA  [c.37.1.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    4e-12  17%  1cr0A  [c.37.1.11] DNA PRIMASE/HELICASE
    5e-12  10%  1jqjA3 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:245 -- 366
    1e-11  12%  1np6A  [c.37.1.10] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
    1e-11   8%  1l3aA  [d.18.1.2] P24: PLANT TRANSCRIPTIONAL REGULATOR PBF-2
    1e-11  18%  1d8jA  [a.4.5.18] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    4e-11  30%  1f2t.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    5e-11  23%  1g6hA  [c.37.1.12] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    5e-11   8%  1esmA  [c.37.1.6] PANTOTHENATE KINASE
    5e-11   9%  1a4iA2 [c.58.1.2] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:2 --
    1e-10  19%  1odfA  [c.37.1.6] HYPOTHETICAL 33.3 KDA PROTEIN IN ADE3-SER2
    5e-10  11%  2fggA1 [d.50.5.1] HYPOTHETICAL PROTEIN RV2632C/MT2708 A:4 -- 87
    6e-10  13%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
    9e-10   9%  1mi8A  [b.86.1.2] DNAB INTEIN
    9e-10  16%  1xzpA1 [a.24.25.1] PROBABLE TRNA MODIFICATION GTPASE TRME A:118 --
    1e-09  12%  1xl3C1 [a.243.1.1] PROTEIN TYPE A C:2 -- 92
    1e-09  12%  2je6I3 [d.51.1.1] EXOSOME COMPLEX RNA-BINDING PROTEIN 1 I:153 --
    2e-09   9%  1bccF  [f.27.1.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    2e-09  15%  1tueA  [c.37.1.20] REPLICATION PROTEIN E1
    3e-09  10%  2vgmA3 [d.79.3.2] DOM34 A:278 -- 381
    4e-09  21%  1uouA3 [d.41.3.1] THYMIDINE PHOSPHORYLASE A:374 -- 480
    6e-09  12%  2pa7A1 [b.82.1.1] DTDP-6-DEOXY-3,4-KETO-HEXULOSE ISOMERASE A:2 --
    3e-08  13%  1g8fA3 [c.37.1.15] SULFATE ADENYLYLTRANSFERASE A:390 -- 511
    3e-08  10%  1e2hA  [c.37.1.1] THYMIDINE KINASE
    1e-07  14%  1gm5A1 [a.24.21.1] RECG A:7 -- 105
    2e-07   9%  1em8A  [c.128.1.1] DNA POLYMERASE III CHI SUBUNIT
    3e-07   7%  3cddA2 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:2 -- 180
    4e-07  10%  1ovmA2 [c.36.1.5] INDOLE-3-PYRUVATE DECARBOXYLASE A:3 -- 180
    7e-07  13%  1yj5A2 [c.37.1.1] 5' POLYNUCLEOTIDE KINASE-3' PHOSPHATASE A:351 --
    2e-06   8%  1g31A  [b.35.1.1] GP31
    6e-06  14%  1heiB1 [c.37.1.14] HCV HELICASE B:188 -- 325
    1e-05   6%  2gtlM1 [b.61.7.1] HEMOGLOBIN LINKER CHAIN L1 M:102 -- 225
    1e-05  17%  1oy5A  [c.116.1.4] TRNA (GUANINE-N(1)-)-METHYLTRANSFERASE
    1e-05  18%  1t9hA2 [c.37.1.8] PROBABLE GTPASE ENGC A:68 -- 298
    1e-05  20%  1w1wA  [c.37.1.12] STRUCTURAL MAINTENANCE OF CHROMOSOME 1
    3e-05   8%  1b77A2 [d.131.1.2] PROTEIN (SLIDING CLAMP) A:111 -- 228
    6e-05  14%  1mkyA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGA A:2 -- 172
    1e-04  13%  2vnuD1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP44 D:400 -- 494
    2e-04  10%  1p5zB  [c.37.1.1] DEOXYCYTIDINE KINASE
    2e-04  27%  1gvnB  [c.37.1.21] ZETA
    2e-04  18%  1do0A  [c.37.1.20] PROTEIN (HEAT SHOCK LOCUS U)
    3e-04  15%  2gujA1 [b.106.1.3] PHAGE-LIKE ELEMENT PBSX PROTEIN XKDM A:5 -- 143
    7e-04  11%  1dwmA  [d.40.1.1] LINUM USITATISSINUM TRYPSIN INHIBITOR
    8e-04  24%  1dekA  [c.37.1.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
:581

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xSIIQKLWWFFKLEKRRYLVGIVALILVSVLNLIPPMVMGRVIDAITSGXXXXXXXXXXXXXXXXAAFGM
2hydA2          --MIKRYLQFVKPYKYRIFATIIVGIIKFGIPMLIPLLIKYAIDGVINNHALTTDEKVHHLTIAIGALFI
1q3hA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1pf4A2          -QTFKRLWTYIRLYKAGLVVSTIALVINAAADTYMISLLKPLLDEGFGNAESNFLRILPFMILGLMFV-R
1sgwA           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1gvnB           ----------------------------------------------------------------------
1do0A           ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           YYLRYVWRMYILGTSYCLGQIMRSRLFKHFTKMSSAFYQTYRTGDLMAHATNDINALTRLAGGGVMSAVD
2hydA2          FVIEFIRQYLAQWTSNKILYDIRKKLYNHLQALSARFYANNQVGQVISRVINDVEQTKDFILTGLMNIWL
1q3hA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1pf4A2          GLSGFASSYCLSWVSGNVVMQMRRRLFNHFMHMPVRFFDQESTGGLLSRITYDSE---------------
1sgwA           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1gvnB           ----------------------------------------------------------------------
1do0A           ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ASITALVTLLTMLFSISWQMTLVAILPLPFMAYTTSRLGRKTHKAFGESQAAFSELNNKVQESVSGIKVT
2hydA2          DCITIIIAL-SIMFFLDVKLTLAALFIFPFYILTVYVFFGRLRKLTRERSQALAEVQGFLHERVQGISVV
1q3hA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1pf4A2          --------------QVAGATSRALVSIVREGASIIGLLTLMFWNSWQLSLVLIVV-------APVVAFAI
1sgwA           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1i1qA           ------------------------------------------------SDDAFGAVVRQLQKAIRAGEIF
2axpA1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1gvnB           ----------------------------------------------------------------------
1do0A           ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           KSFGYQADELKSFQAVNELTFQKNLQTMKYDSLFDPMVLLFVGSSYVLTLLVGSLMVQEGQITVGNLVTF
2hydA2          KSFAIEDNEAKNFDKKNTNFLTRALKHTRWNAYSFAAINTVTDIGPIIVIGVGAYLAISGSITVGTLAAF
1q3hA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1pf4A2          SFVSKRFRKISRNMQTAMGHRQQTMKLVSAQSIADPVIQMIASLALFAVLFLASVDSIRAELTPGTFTVV
1sgwA           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
2iqhA1          --------------------------------------------------------ATEIRASVGKMIGI
1bmfA3          ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1qhdA1          -------------------------------------------------------IGNLPIRNWNFDFGL
1urjA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1i1qA           QVVPSRRFSLPCPSPLAAYYVLKKSNPSPYMFFMQDNDFTLFGASPESSLDAASRQIEIYPIAGTRPRGR
2axpA1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1cd5A           -----------------------------------------------------------------RLIPL
1e6cA           ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1gvnB           ----------------------------------------------------------------------
1do0A           ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ISYLDMLVWPLMAIGFLFNTTQRGKVSYQRIENLLSQESPVQDPEFPLDGIENGRLEYAIDSFAFENEET
2hydA2          VGYLELLFGPLRRLVASFTTLTQSFASMDRVFQLIDEDY-------------------------------
1q3hA           -------------------------------------------------------------HLCLVGNPV
1b0uA           -------------------------------------------------------------HKRYGGHEV
1e69A           -----------------------------------------------------------LKKLYLKGFKS
1pf4A1          ---------------------------------LMDLETERDNGKYEAERV-NGEVDVKDVTFTYQGKEK
1m3eA1          ---------------------------------------------------------------------D
1l7vC           ----------------------------------------------------------------------
1pf4A2          FSAMFGLMRPLKALTSVTSEFQRGMAACQTL---------------------------------------
1sgwA           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1ji0A           -------------------------------------------------------------HVYYGAIHA
1ex6A           ----------------------------------------------------------------------
2iqhA1          GRFYIQMCTELKLSDYEGRLIQNSLTIERMVLSAFDTGGPIYRRVWRRELILYDKEEIRRIWRQANNGDD
1bmfA3          ---------------------PVGEELLGRVVDALGNAIDGKGPIGRVGLKAPGIIPRISVREPMQTGIK
1jalA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1t06A           --------------------------------------------------------------------KT
1khbA1          ----------------------------------------------------------------LAEHML
1rkbA           ----------------------------------------------------------------------
1qhdA1          LGTTLLNLDANYVETARNTIDYFVDFVDNVCMDEMVRESQRNGIAPQSDSLIKLSGIKFKRINFDNSSEY
1urjA           ----------------------------------FSDYTPRPGDLKHETTGEALCERLGLDDRALLYLVV
1jjvA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1e9rA           -------------------------------------------------------------TREKAKQVT
2gx8A1          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1qhlA           ------------------------------------------------------RGK--FRSLTLINWNG
1pv4A3          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1mjgM           -------------------------------------------------------------KLDLPINFG
1zp6A1          ----------------------------------------------------------------------
1n25A           ---------------------------------------------------------CLLPKMDSVVYDF
1ni3A1          ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1i1qA           RADGTLDRDLDSRIELDMRTDHKELSEHLMLVDLARNDLARICTPGSRYVADTKVDRYSYVMHLVSRVVG
2axpA1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1cd5A           TTAEQVGKW---AARHIVNRINAFKPTADRPFGLPTGGTPMTTYKALVEMHKAGQVSFKHVVTFNMDEYV
1e6cA           ----------------------------------------------------------------------
1g6oA           -------------------------------------------------------------NLLDNKEQA
1tljA           -------------------------------------------------------------VWEELREKA
1vplA           -------------------------------------------------------------RKRIGKKEI
1j1zA2          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1c4oA1          -------------------------------------------------------------SPKGDQPKA
1vhhA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1s9hA           -------------------------------------------------------------DPQYAASVF
1f8xA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------DFADQF
2qgmA1          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------PGIRITEGRHPV---VEQVLNEPF
1afrA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------MDLPRS
1fl9A           -------------------------------------------------------------MLRFGKKFA
1atrA1          ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1jbkA           ------------------------------------HMQALKKYTIDLTRAEQGKLDPVIG-----RDEE
1sbxA           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1g8yA           -------------------------------------------------------------LEAFAAAPP
3cddA1          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1jqjA3          --------------------------------------------------AGCDLLKQAFARAAAASNEK
1np6A           ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1g6hA           -------------------------------------------------------------VKYFGEFKA
1esmA           ------LXTPYLQFDAALRDSVPXTLSEDEIARLKGINEDLSLEEVAEIYSRLLNFYISSNL-RRQAVLE
1a4iA2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1mi8A           -------------------------------------------------------------LDEKDFEIW
1xzpA1          ----------------------------RELIEVLAEIRVELDYPDE-IETNTGEVVTRLERIKEKLTEE
1xl3C1          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1tueA           -----------------------------------------------------------------TFLGA
2vgmA3          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------IGITRS
1ovmA2          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
2vnuD1          ---------------------------YVGQLAPSSVDPQSSSTQNVFVILXDKCLKVRIRAELLDKRIV
1p5zB           ----------------------------------------------------------------------
1gvnB           -----------------------------------------------------------------DNLEE
1do0A           ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LTDIHFSLAKGQTLGLVGQTGSGKTSLIKLLLREYDVDKGTIXLNGHDIRDYRLTDLRSLMGYVPQDQFL
2hydA2          ----------------------------------------------------------------------
1q3hA           LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIIFGV
1b0uA           LKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNINLVRDKDRTRLTMVFQHFNLW
1e69A           FGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENLPPAGSAYVELVFEENGEEITV
1pf4A1          LSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDVRDYKLTNLRRHFALVSQNVHL
1m3eA1          AVEAVKDIPNGATVLVGGFGLCGIPENLIGALLKTGVKELTAVSNNAGVDNFGLGLLLQSISSYVGENAE
1l7vC           LGPLSGEVRAGEILHLVGPNGAGKSTLLARXAGXTS-GKGSIQFAGQPLEAWSATKLALHRAYLSQQQTP
1pf4A2          ----------------------------------------------------------------------
1sgwA           LERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGVPITKVKGKIFFLPEEIIVPRKIS
1nijA1          ---------PIAVTLLTGFLGAGKTTLLRHILNEQHGYKIAVIENEFGEVSVDDQLIGDRATQIKTLTNG
1poiA           --AIAKYVHSGDHIALGGFTTDRKAAVFEILRQGITDLTGLGGAAGGDWDMLIGNGRVKAYCYTANSGTN
1ji0A           IKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDITNKPAHVINRXGALVPEGRRI
1ex6A           -----------RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVNGKDYNFVSVDEFKS
2iqhA1          ATHSNLNDATYQRTRALVR-TGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTMVMELIRMIKRGINRRTR
1bmfA3          AVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRLT
1jalA1          ----------GFKCGIVGLPNVGKSTLFNALTKAGPFCTIEPNTGVVPMPDPRLDALAEIVKPERILPTT
1mukA           ---------------RMCEAREPSVDLRLPLCAGIDPLNSDPFLKMVSVGP-MLQSTRKYFAQTLFMAKT
1yvuA2          ---------KGKSLILAQTREEAKEKLIPVINKIKDVDLVIVFL--EFLLYDFVKRELLKKXIPSQV-IL
1t06A           VMQELEALGKERTKKIYISNGAHEPVFGVATGAMKPIAKKIK--LNQELAEELYATGNYDAMYFAGIIAD
1khbA1          VLGITNPEGEKKYLAAAFPSACGKTNLAMMNPSLPGWKVECVGDDIAWMKFDAQGHLRAINPENGFFGVA
1rkbA           -------LMLLPNILLTGTPGVGKTTLGKELASKSGLK--YINVGDLAREEQLYDGYDEEYDCPILDEDR
1qhdA1          IENWNLQNRRQRTSVLADASETMLANVTS-VRQEYAIPVGPVFPPGMNWTD--LITNYSPSREDNLQRVF
1urjA           TEGFKEAVCINNTFLHLG--GSDKVTIGGAEVHRIPVYPLQLFMPDFSRVIAEPFNANHREKFTYPLPFF
1jjvA           ----------TYIVGLTGGIGSGKTTIANLFTDLGVPLVDADVVAREVVAKDS--PLLSKIVEHFGAQIL
1jqjA2          ----------------------------------------------------------------------
1ffhA2          --ARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPAAREQLRLLGEKVGVPVL
1grqA           ---------TTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADGGV
1udwA           ---------EPFLIGVSGGTASGKSSVCAKIVQLLQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPD
1e9rA           VAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRT
2gx8A1          --------------GAGHIGNYSHCTFSSEGTGTFVPQQLEVRIETIIPASLQRKVIKAMVTAHPYEEVA
1bgxT2          ---------------------------MRGMLPLFEPKGRVLLVDGH--------------HLAYRTFHA
1xbtA1          ---------RGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKTRALPACLLRDVAQEALGVAV
1kgdA           ---------MRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPEENGKNYYFVSHDQMMQDIS
1qhlA           FFARTFDLDELVT-TLSGGNGAGKSTTMAAFVTALIPDLTLLLHGKLKAGVCYSM-----LDTINSRHRD
1pv4A3          --DLASPIGRGQRGLIVAPPKAGKTXLLQNIAQSIAYNHPDCVLXVLLIDERPEEVTEXQRLVKGEVVAS
2yyeA2          -----SGAQVGQLLILTKPIGTGILIKGLKEGILKEEDINEAIENMLALRNLMLSLDATACTDVTGFGLA
2gk3A1          ------------------------------------------------------------LKVLFIGESW
2v3jA1          --VLTSKDKITKRXIVVLAXASLETHKIYVLLNCDDHQGLKKXGRDISEARPDITHQCLLTLLDSPINKA
1mjgM           PAFEGESIRKGDMYVEMGGNRTPAFELVRTVSESEITDGKIEVIGPDIDQIPEGSKLP--LGILVDIYGR
1zp6A1          ---------GGNILLLSGHPGSGKSTIAEALANLPGVPKVHFHSDDLWGYIKHGRIDPWLP-QSHQQNRX
1n25A           LKCMVYNIPKKRYWLFKGPIDSGKTTLAAALLELCGGKALNVNLGVAIDQFLVVFEDVKGTGGESRDLPS
1ni3A1          --VQWGRPGNNLKTGIVGXPNVGKSTFFRAITKSVLGNPANYPYATIDPEEAKV-AVPDERFDWLCEAYK
1ii8.1          ---------------------------LARTERERVKKEIKDLEKAKDFTEELIEKVKKYKALAREAALS
1t3wA           -----------------------KRTTXRILIGVQNPELATLVPPLENLDENKLPGLGLFRELVNTCLSQ
1l7lA           --EVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGL-ICHDAFCGALVMKIGN
1o7d.2          ----------------------------------------------------------------------
1i1qA           RHDLDALHAYRACMNMGTLSGAPKVRAMQLIADAEGQRRGSYGGAVGY--------------FTAHGDLD
2axpA1          -------------IILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSGNEKLFEHFNKDNVIIDRFV
1f46A           ----------------------------EAVIIMNVAAHHGSELNGELLLN-----SIQQAGFIFGDMNI
1zs3A1          -------------------------------------------------------------AEIDHHKPT
1zbsA1          ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1viaA           -----------KNIVFIGFXGSGKSTLARALAKDLDLVFLDSDFLIEQKFNQKVSEIFEQKRENFFREQE
1iioA           ----------------------------------------------------------------------
1jb1A           --GVLVDI-YGLGVLITGDSGVGKSETALELVQRGHRLIADDRVDVYQQDEQTIVGAAPPILSHLLEIRG
1tmkA           --------GRGKLILIEGLDRTGKTTQCNILYKKLQPNCKLLKFPERSTRIGGLINEYLTDDSFQLSDQA
1dnpA2          ----------------------------------------------------------------------
1q3tA           ---------KTIQIAIDGPASSGKSTVAKIIAKDFG---FTYLDTGAMYRAATYMALKNQLGISFGRSET
1lw7A2          -------PFFAKTVAILGGESSGKSVLVNKLAAVFNTTSAWEYGREFVFEKLGGDEQAMQYSDYPQXALG
1cd5A           LPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSYGKIHLFMGVGNDGHIAFN
1e6cA           -----------EPIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQHTSGMTVADVVAAEGWPESEALQ
1g6oA           ISAIKDGIAIGKNVIVCGGTGSGKTTYIKSIXEFIPKEERIISIEDTEEIVFKHHKNY--TQLFFGGNIT
1tljA           LNKIYHDKEIGYLDPDILGFLLAFYRNRNDVY-TQSSCSGRI-TIVDAEMPWDRKNSTIIFKNHLRITEQ
1vplA           LKGISFEIEEGEIFGLIGPNGAGKTTTLRIISTLIKPSSGIVTVFGKNVVEEPHEVRKLISYLPEEAGAY
1j1zA2          ----------------------------------------------------------------------
1pgsA2          -----NTEKAYLRTTISGWGHAKPYDAGSRGCAEWCFRTHTIAINNANTFQHQLGALGCSANPINNQSPG
1c4oA1          IAGLVEALRDGEFVTLLGATGTGKTVTMAKVIEALGRPALVLAPNKILAAQLAAEFRELFPENAVEYFIS
1vhhA           ----------------------------------------------------------------------
1d6jA           SERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRF--GLNKDLGFSEADRNE
2f9hA1          ----------------------------------------------------TVTEIGKHAIDDSEKXII
1s9hA           LGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFPFND---CVDKMVIWWEEGKMT
1f8xA           ----------------------------------------------------------------------
1ckvA           FADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPWIKANGKIEVDCDEISELLGRQFNVYDF
2qgmA1          ----------------------------------------------------------------------
1e3mA2          IANPLNLSPQRRXLIITGPNXGGKSTYXRQTALIALXAYIGSYVPAQKVEIG---PIDRIFTRVGFXVEX
1afrA           HVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDPAMLNTLDGVRDETGASPTSWAIW
1l1oA           INAGMLAQFIDKPVCFVGRLEKIHPTG--KMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATI
1fl9A           EILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQGNVKSPTYTLVEEYN----IAGKMIYHFDLYR
1atrA1          --GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAK
1es6A2          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1mm8A           ---------------------------------------------------------------------D
1ak2A1          ---------KGVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLV
1v47A1          ----------------------------------------------------------------------
1jbkA           IRRTIQVLRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLKGRRVLALDMGALVAGAKYRGEFEER
1sbxA           ----------------------------------------------------------------------
1ohcA1          -------------------------------------PQDDVYLDITDRLCFAILYPKSASNVHYFSIDL
1g8yA           LDYVLPNMVAGTVGALVSPGGAGKSMLALQLAAQIAGGPDLLEVGELPTGPVIYLPAEDPPTAIHHRLHA
3cddA1          ----------------------------------------------------------------------
2ancF1          ---------QGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQVLATGVDVFLDIDRQKMPHARSIF
1ckeA           --------AIAPVITIDGPSGAGKGTLCKAMAEAL----QWHLLDSGAI--YRVLALAALHHHVASEDAL
1cr0A           INDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMG---------KKVGLAMLEESVEETAEDLI-
1jqjA3          FRGVRLYVSENQLKITANNPEQEEA-----------EEILDVTYSGAEMEGFNVSYVLDVLNALKCENVR
1np6A           ----------IPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTHHELRKAGAAQTIVASQQRWAL
1l3aA           ---------------------------------------GYSIYKGKAALTVEPRSPEFSPLDSGAFKLS
1d8jA           ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1g6hA           LDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEPAELYHYGITFQTPQPL
1esmA           QFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRRVELITTDGFLHPNQVLKERGLXKKKGF
1a4iA2          ----------------------------------------------------------------------
1odfA           -------------IFFSGPQGSGKSFTSIQIYNHLEKYGGEKSIGYASIDDFYLTH---------EDQLK
2fggA1          ----------------------------------------------------------------------
1yr6A1          -------------VVFVGTAGSGKTTLTGEFGRYLEDNYKVAYVNLDTGVKELPYESIDVREFVTVEEIM
1mi8A           AINEQTMKLESAKVSRVFMTGKKLVYILKTRLGRTIKATANHRFLTIDGWKRL-DELSLKEHIALPRKIS
1xzpA1          LKKAD---AGILLNRGQEIFERGSDSLITNLRQKQLEDAIKSLKEGMPVDMASIDLERALNLLDEVTGRS
1xl3C1          ----------------------------------------------------------------------
2je6I3          --GIVIDIMPVKVPRVIGKNKSMYETLTSKSI--FVANNGRIWAFSEEILIEAIRKIENESH--------
1bccF           --------------------------------------------------RWLEGIRKWYYNAAGNKYGL
1tueA           LKSFLKGTPKKNCLVFCGPANTGKSYFGMSFIHFIQGAVISFVNSTSHFWLEPLTDTKAMLDDATTTCWT
2vgmA3          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1g8fA3          ---------QGFSIVLGNSLTVSREQLSIALLSTFLQFGGGRYYKIFEHNNKTLIQDFIGSGSGLIIPDQ
1e2hA           -------MPTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGEIS
1gm5A1          ---------------------------------------------------------------------L
1em8A           ----------------------------------------------------------------------
3cddA2          LEAXSGAFDLEXTYKFLGNDAQYKAFIEPIKQGQACTVDIGGERVITGYVDDWVPSYDESTITISVSGRD
1ovmA2          SYAADGYARCKGFAALLTTFGVGELSAMNGIAGSYAEHVPVLHIVGAPGTAAQQRGEL--LHHTLGDGEF
1yj5A2          ----------------VGFPGAGKSTFIQEHLVSAGYVHVNRDTLGSWQRCVSSCQAALRQGKRVVIDNT
1g31A           ----------------------------------------------------------------------
1heiB1          -SSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVGSPITYSTYGKFLADGG--CSGGA
2gtlM1          TLSYELDEHDHTVSTTQLRGFYNFGK-RELLLAPLKGQSEGYGVICDFNLGDDDHADCKISLFVCAHFNA
1oy5A           ---------------------------------KQAIKKGKVEVYPIDLREFGQVDDVPYGGMVLKPEPI
1t9hA2          ---------------------------------------GGLVADTPGFSSLEFTDIEEELGYTFPDIRE
1w1wA           ----------------------------------------------------------------------
1b77A2          VASVITEIKAEDLQQLL-----RVSRGLQIDTIAITNKDGKIVINGYNKVEDSGLTRPKYLTLTDYDGSN
1mkyA1          -------------VLIVGRPNVGKSTLFNKLVKDPVQDTVEWYGKTFKLVDTCGVFDNPQDIISQKXKEV
2vnuD1          ISIDSWPYPLGHFVRDLGTIESAQAETEALLLE-------------------------------------
1p5zB           ---------RIKKISIEGNIAAGKSTFVNILKQLCE-DWEVVPEPVARWCNVQSTNGGNVLQMMYEKPER
1gvnB           LIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGN--VIVIDNDTFKQQ------------------
1do0A           ---------------MIGPTGVGKTEIARRLAKLANAPFIKV--EATKFTE---------VGYVGKEVDS
2gujA1          -------------------VKKGSDPYFTLQAVLDDQSSGRVTLYDVNFDSAKIASLDEEVPFTFED---
1dwmA           ----------------------------------------------------------------------
1dekA           -------------IFLSGVKRSGKDTTADFIMSNYSAVKYQL---AGPIKDAL-----------------


                         .         .         +         .         .         .         .:490
query           FATSILDNIRFGNPNLPLSAVVEATKLARVYQDIVDMPQGFDTLIGEKGVSLSGGQKQRLAMSRAMILEP
2hydA2          ----------------------------------------------------------------------
1q3hA           SYDEYRYKSVVKAC--------------QLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDA
1b0uA           SHMTVLENVMEA---PIQVLGLSKHDARERALKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEP
1e69A           ARELKRTGENTYYLNGSPVRLKDIRDRFAGTGLGVDFYSRKPGRRDQKLSLLSGGEKALVGLALLEIKPS
1pf4A1          FNDTIANNIAYAEGEYTREQIEQAARQAHAMEFIENMPQGLDTVIGENGTSLSGGQRQRVAIARALLRDA
1m3eA1          FERQYLAGELEV-ELTPQGTLAERIRAGGAGVPAFYTSTGYGTLVQEGGSPIKYNKDGSIAIASKPREVR
1l7vC           FATPVWHYLTLHQHDKTRTELLND----------VAGALALDDKLGRSTNQLSGGEWQRVRLAAVVLPAG
1pf4A2          ----------------------------------------------------------------------
1sgwA           VEDYLKAVASLYGVKVNKNEIMDALES------------VEVLDLKKKLGELSQGTIRRVQLASTLLVNA
1nijA1          CICCSRSN-ELEDALLDLLDNLDKGNIQFDRLVI-------ECTGMADPGPIIQTFFSHEVLCQRYLLDG
1poiA           VSRRFRKWFEAGKLDYSQDVIYMMWHAAALGLPFLPVTLMQGSGLTDEWGISKEVRKTLDKVPDDKFKYI
1ji0A           FP----ELTVYENLXXGAYNRKDKEGIKRDLEWIFSLFPRLKERLKQLGGTLSGGEQQXLAIGRALXSRP
1ex6A           MIKNN-------EFIEWAQFSGNYYGSTVASVKQVSKSGKTCILDIDMQGVKSVKAIPELNARFLFIAPP
2iqhA1          AYERMCNILKGKFQTAAQRTMVDQ---VRESRNPGNAEFEDLIFLARSALILRGSVAHKSCLPACVYGSA
1bmfA3          DADAMKYIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGRE
1jalA1          MEFVDIAGLVAGASKGEGLGNKFLANIRETD----AIGHVVRCFENIDPLDDIDTINTELALADLDSCER
1mukA           VSGNAIDSALLRLRTLGADKKALTAQLLMVGLQESEADALAGKIML--------QDVNTVQLARVVNLAV
1yvuA2          NRTLKNENLKFVLLNV---AEQVLAKTGNIPYKLKEIEGKVDAFVGIDISRITRDGKTVNAVAFTKIFNS
1t06A           PKAMSESDFDRWIDGAYFYMLSDY------VVAVTLSESNIAQDVADKWIASGDELKMSAGYCWLLGNRK
1khbA1          PGTSVKTNPNAIKTIQKNTIFTNVAE--TSDGGVYWEGIDEPLASGVTITSWKNKEWSSEDGEPCAHPNS
1rkbA           VVDELDNQMREGGVIVDGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEA
1qhdA1          TVASIRSML-------------------------------------------------------------
1urjA           NRPAVVGPAAVALRSRNVDAVARAA--AHLAFDENHEGAALPADITFTAFAGGFEQRLASVMAGDAALAS
1jjvA           NRAALRERVFN-----------------HDEDKLWLNNLLHPAIRERMKQKLAEQTAPYTLFVVPLLIEN
1jqjA2          ------SEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELRTVATDGHRLAVCSMIVPRK
1ffhA2          EVMDGESPESIRRRVEEK---------------------ARLEARDLILVDTAGRLQIDEPLMGELARLK
1grqA           S-----IGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLW------VGVRC
1udwA           AFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPDVVLFEGILAFYSQEVRDLFQMKLFVDTD
1e9rA           KGWSFFNEIRN----DYDWQRYALSVVPRGKTDEAEEWASYG--RLLLRETAKKLALIGTPSMRELFHWT
2gx8A1          YDVYPLDNKGETLGLGK-------IGYLQEEMTLGQFAEHVKQSLDVKGARVVGKLDDKVRKVAVLGGDG
1bgxT2          LKLTTSRGEPVQAVYGFAKSLLKALKEDGDAVIVVFDAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIK
1xbtA1          IGIDEGQFFPDI-------------VEFCEAMANAGKTVIVAALDGTFQRKPFGAILNLVPLAESVV---
1kgdA           NNEYLEYGSHEDAMY------------GTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAA
1qhlA           RKVDIKPFAIQGLPMSVQPTQLVTETLNERQARVLDKLEAMEGVQFKQFNSITDYHSLMFDLLRSASDRS
1pv4A3          TFD---EPASRHVQV-----------AEXVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPAVLTGGV
2yyeA2          WNICKNSNIGARIF---FEKVPYYQLSENLVKKKIYPKGAIENLNFVKNYLKSNLDNWKLILLSDPVTSG
2gk3A1          HHXIHSKGYDSSKYEEGATWLLECLRKG----GVDIDYXPAHTVQIAFPESIDELNRYDVIVISDIGSNT
2v3jA1          GKLQVYIQTSRGILIEV-----NPTVRIPRTFKRFSGLXVQLLHKLSIRSEEKLLKVIKNPITDHLPTKC
1mjgM           KMQADFEGVLERRIHDFIN------YGEGLWHTGQRNINWLRVSKDAVAKGFRFKNYGEILVAKMKEEFP
1zp6A1          IXQIAADVAGRYAKEGYFVILDGVVRPDWLPAFTALARPLHYIVLRTTAAEAIERCLDRGG--DSLSDPL
1n25A           GQGINNLDNLR--DYLDGSVKVNLEKKHLNKRTQIFPPGIVTMNEYSVPKTLQARFVKQIDFRPKDYLKH
1ni3A1          PKSRVPAFLTVFDIAGLTKGASTGVGLGNAFLSHVRAVD----AIYQVVRAFDDAEIIHVEGDVDPI--R
1ii8.1          KIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLTFLSGGERIALGLAFRLAMSLYLAGEI
1t3wA           PGLTTGQLLEHYRGT------------NNAATLEKLSXWDDIADKNIAEQTFTDSLNHXFD--SLLELRQ
1l7lA           SGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGK-----------------------
1o7d.2          -------------------------------------------------IVYNPLGRKVDWMVRLPVSKH
1i1qA           TCIVIRSALVEN-GIATVQAGAGIVLDSVPQSEADETRNKARAVLRAIATAHHA----------------
2axpA1          YSNLVYAKKFKDYSILTERQLRFIEDKIKAKAKVVYLHADPSVIKVRGDEYIEGKIDSILELYREVXSNA
1f46A           YHRLSPDGSGPALFSLANMVKPGTFDPEMKDFTTPGVT---IFMQVPSYGDELQLFKLMLQSAQHIADEV
1zs3A1          AGAHVLSNLFIENIRLTAGIYAKSPVKCEYLREIAQREVEYFFKISD----LLLDENEIVPSTTEEFLKY
1zbsA1          ------EGIACI-------LGTGSNSCLFDGREIKANVSPLGYILGDEGSGAVLGRLFIGSLLKGQXPEG
1bs2A1          ---------------------------------------------------LRSVERNASGITQEKWINA
1viaA           QKXADFFSSCEKACIATGGGFVNVSNLEKAGFEYLKKRLDKDEISKRPLFYDEIKAKKLYNERLSKYEQK
1iioA           ------SHMKMGVKEDIRGQIIGALAGADFEELMAALPNGPDTTCKSGDVELKASDAGQVLTADDFPFSA
1jb1A           LGIIDVXNLFGAGAVREDTTISLIVHLEN----WTPDQLIFDVPVPKITVPVKVGRNLAIIIEVAAXNFR
1tmkA           IHLLFSANRWEIVDKIKK----DLLEGKNIVMDRYVYSGVAYSAAKGTNG----MDLDWCLQPDVGLLKP
1dnpA2          -------HLVWFRQDL---RLHDNLALAAACRNSSARVLALYIATPRQWATHNMSPRQAELINAQLNGLQ
1q3tA           GDQLVFVGDVDITHPIRENEVTNHVSAIAAIPEVREKLVSLQQEIAQQGGIVMDGR----DIGTVVLPQA
1lw7A2          HQRYIDYAVRHSHKIA---------------------FIDTDFITTQAFCIQYEGKAHPFLDSXIKEYPF
1cd5A           EPASSLASRTRIKTLTHDTYALTVGVGTLLDAEEVMILVLGSQKALALQAAVEGCVNHMWTISCLQLHPK
1e6cA           AVATPNRVVATGGGMVLLEQNRQFMRAHGTVVYLFAPAALRLQASLQAHQRPTLTGRPIAEEMEAVLRER
1g6oA           SADCLKSCLRXR----PDRIILGELRSSEAYDFYNVLCSGHKGTLTTLHAGSSEEAFIRLASNSAARNIK
1tljA           DLEDVLSKNQVRRLWLIVQGPIIHIYAKNIETGWDILKIAREA--GFKHSGILATNQKGVLVELRTGIRM
1vplA           RNMQGIEYLRFVAGF-----YASSSSEIEEMVERATEIAGLGEKIKDRVSTYSKGMVRKLLIARALMVNP
1j1zA2          ---SMDANLLHISYEGGVLPPKGMFRMTQDPEEAPDAPEYVEVFFEGDPVAVNGERLSPAALLQ----RL
1pgsA2          NWTPDRAGWCPGMAVPTRIDVLNNSLTGSTFSYEY-----------------------------------
1c4oA1          YYDYYQPEAYVPGKDLYIEKDASINPEIERLRH--STTRSLLTRRDVIVVASVSAIYGLGDPREYRARNL
1vhhA           -----------------LTPLAYKQFIPNVAEKTLGAS------GRYEGKITRNSERFKELTPNYN---P
1d6jA           NIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVA-----------TPGEETGLPFVEVYVDVP
2f9hA1          LFGTATDTLKQHAVIQSFPEKDQVTLA-----EGDHLKIGDTNYTITKVGSFANSNLQSIAHSTLIFADA
1s9hA           AKVESAKAILGGSK----------VRVDQKCKSSAQIPTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRM
1f8xA           --------------------------------------------IYFGAGWFTDRQNKAYKEAMEALKEN
1ckvA           LVDVSSTIGRAYTLG---NKFTITSELMGLDRKLED----------------------------------
2qgmA1          ---------------------------SVQKNIVKSIQSQANPLKTI----EPSKPFEDLKPLKKXIGNA
1e3mA2          TETANILHNATEYSLVLXDEIGRGTSTYDGLSLAWACAENLANKIKALTLFATHYFELTQLPEKXEGVAN
1afrA           TRAWTAEENRHGDLLNKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTENSPYLGFIYTSFQERATFISHGN
1l1oA           LCTSYVQF-KEDSHPFDLGLYNEAVKIIH------DFPQFYPLGI-------------------------
1fl9A           LADPEELEFMGIRDYFNTDSICLIEWSEKGQGILPEALVNIDYYDDARNIELIAQTNLGKNIISAF----
1atrA1          RLIGVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLN
1es6A2          ---SFHPKLRPI---LLPNKNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVLKLTGGQP
1dhyA1          -----------------------IERLGYLGFAVKDVP-AWDHFLTKSVGLMAAGSAGDAALYRADQRAW
1mm8A           WAKSVFSSAALGDPRRTARLVNVAAQLAKYKAAQEGAYRFIRNPNVSAEAIRKAGAMQTVKLAQ----EF
1ak2A1          SDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLI
1v47A1          ---------------------------------------------------------PALEIGEDERLDL
1jbkA           LKGVLNDLAKQEGNV-ILFIDELHTMVGAMDAGNMLKPALARGELHCVGATTLDEYRQYIEKDAALERRF
1sbxA           --------------------------------------------------DRSTERCETVTISCFVVGGE
1ohcA1          EYENFYADFGPLNLAMVYR---YCCKINKKLKSI--------TMLRKKIVHTGSDQRKQANAAFLVGCYM
1g8yA           LGAHLSAEERQA------------------VADGLLIQPLIGSLPNIMAPEWFDGLKRAAEGRRLMVLDT
3cddA1          ----------------------VSLILGDNVKAARGRFSWRQRFSKF----TIKAAKADVTDSEIGRYRP
2ancF1          ILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSR
1ckeA           VPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLIADG
1cr0A           ---GLHNRVRLRQSDSLKREIIENGKFDQ----WFDELFGNDTFHLYDSFA-EAETDRLLAKLAYMRLGC
1jqjA3          MMLTDSVSSVQIEDAASQSAVVMPMRL-------------------------------------------
1np6A           MTETPDEEE--------------------LDLQFLASRMDTSKLDLILVEGFKHEEIAKIVLFRDGAGHR
1l3aA           REGMVMLQFAPAAGVRQYDWSRKQVFSLSVTEIG-SIISLGTKDSCEFFHDPNKGRSDEGRVRKVLKVEP
1d8jA           LSGSSGYKFGV------LAKIVNY--MKTRHQRGDTHPLTLDEI-LDETQHLDIGLKQKQWLTEALVNNP
1f2t.1          ---------------------------------------------------LSGGERFRLAMSLYLAGEI
1g6hA           KEMTVLENLLIGEICPGESPLNSLFYKKWIPKEEEMVEKKLSHLYDRKAGELSGGQMKLVEIGRALMTNP
1esmA           PESYDXHRLVK------------------------FVSDLKSGVPNVTAPVYSHLIYDVIPDGDKTVVQP
1a4iA2          ---------------------------------------------------------------------P
1odfA           LNEQFKNNKLLQGRGLP-----GTHDMKLLQEVLNTIFNQDTVVLPKYDKSQFKGEGDRCPTGQKIKLPV
2fggA1          ---------------------------------------EEHDERTRAKARLSWAGRQXVGVGLAR----
1yr6A1          REGYGPNGAIVESYDRLMEKFNEYLNKILRLEKENDYVLIDTPGQMETFLFHEFGVRLMENLPYPLVVYI
1mi8A           WDSIVSITETGVEEVFDLTVPGPHNFVA------------------------------------------
1xzpA1          FREDLLDTIF------------------------------------------------------------
1xl3C1          ---FMGDIVALVDXRAGIHDIEHLANAFSLPTIXVRFYQDLXRMFRLFPLGVFSDEEQRQNLLQMCQNAI
2je6I3          ----------------------------------------------------------------------
1bccF           MRDTIYENDDVKEAIRRLPE--------NLYDDRMFRIKRALDLNMRQQILPKEQWTKYEEDVPYLEPYL
1tueA           YFDTYMRNALDGNP--------------------------------------------------------
2vgmA3          --------------------------------------------LNKDDDKAWYGE-KEVVKAAEYGAIS
1uouA3          ----------------------------------------------------------------------
2pa7A1          -------------------------SIKRVYY-IFDTKGEEPRGLEQVLVCLNGSCRVILDDGNI----I
1g8fA3          WEDDKDSVVGKQNVYLLDTSSSADIQLESADEPISHIVQ-------------------------------
1e2hA           AGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQA
1gm5A1          FLWEALPTLLEEFLNEVEKMLKNQVNTRR----IHQLLKELDDPLLENK-DLEEKLQAFLDYVKEIP---
1em8A           --------------------------------------------------------------------NA
3cddA2          KTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTDVGEPFQRIQIEQGETPHELLAR-LAKQR
1ovmA2          RHFHMSEPITVAQAVLTEQNACYEIDLRERRPGYLMLPA-------------------------------
1yj5A2          NPDVPSRARYIQCAKDAGVPCRCFNFCATIEQARHNNRFREXTDPSHAPVSDXVXFSYRKQFEPPTLAEG
1g31A           ---------------------------------------------------------------PIRAVGE
1heiB1          YDIIICDEC-------------------------------------------------------------
2gtlM1          Q---------------------------------------------------------------------
1oy5A           YEA--YDYVVENYGKPFVLITKLVNELSK-KERIMIIKKIVDMEISLGDFILSGGEIVALAVIDAVSRVL
1t9hA2          KSSCKFRGCLHLKE--PKCAVKQAVEDGELKQYRYDHYVE-----------FMTEIKDR-----------
1w1wA           ---------------------------------------------------LSGGEKTVAALALLFAINS
1b77A2          NFVINMANMKIQPGNYKVML-WGAGDKVAAKFESSQVSYVIMEADST-----------------------
1mkyA1          TLNXIREADLVLFVV---DGKRGITKEDESLADFLRKSTVDTILVANK-AENLREFEREVKPELYSLGFG
2vnuD1          ----------------------------------------------------------------------
1p5zB           WSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYI-------------------------
1gvnB           ----------------------------------------------------------------------
1do0A           IIRDLTDAAVK---------MVRVQAIEKNRYRAEEEERILDVLIPP-----------------------
2gujA1          ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           DILILDDSLSAVDAKTEYAIIDNLKETRKDKTTIITAHRLSAVVHADLILVLQNGQIIERGRHEDLLALD
2hydA2          ----------------------------------------------------------------------
1q3hA           DLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLR
1b0uA           DVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVTHEMGFARHVSSHVIFLHQGKIEEEGDPEQVFGPQ
1e69A           PFYVLDEVDSPLDDYNAERFKRLLKENSKHTQFIVITHNKIVMEAADLLHGVTMVNGVSAIVPVEV----
1pf4A1          PVLILDEATSALDTESERAIQAALDELQKNKTVLVIAHRLSTIEQADEILVVDEGEIIERGRHAD-----
1m3eA1          EFNGQHFILEEAIRGDFALVKAWKADQAGNVTFRKSARNFNLPXCAAETTVVEVEEIVDIGSAPEDIHIP
1l7vC           QLLLLDEPXNSLDVAQQSALDKILSALCQQGLAIVSSHDLNTLRHAHRAWLLKGGKXLASGRREEVLT--
1pf4A2          ----------------------------------------------------------------------
1sgwA           EIYVLDDPVVAIDEDSKHKVLKSILEILKEKGIVIISSR-EELSYCDVNENLHKY---------------
1nijA1          VIALVDAVHADEQMNQFTIAQSQVG--YADRILLTKTDVAGEAEKHERLARINARAPVYTVTHGDIDLLF
1poiA           DNPFKPGVVAVPVPQVDVAIIHAQQASPDGTVRIGKFQDVDIAEAAKYTIVTCE-EIIEIRRDPTKNDIP
1ji0A           KLLXXDEPSLGLAPILVSEVFEVIQKINQEGTTILEQNALGALKVAHYGYVLETGQIVLEGKASELL---
1ex6A           SVEDLKKRLEGRGTETEESINKRLSAAQAELAYAETGAHDKVIVNDDLDKAYKELKDF------------
2iqhA1          VASGYDFEREGYSLVGIDPFRL-----LQNSQVYSLIRPNENPAHSQLVWMACHSAAFEDLRVSS----F
1bmfA3          AYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVSAYIPTNVISITDGQIFL-ETELFYKGIRPAINVGL
1jalA1          AIQRLQKRAKGGDKEAKFELSVMEKILPVLENIRSVGLDKEELQAIKSYNFLTLKPTMYIANVNEDGFEN
1mukA           PDTWMSLDFDSMFKHHVKLLPKDGRH-------LNTDIPPRMGWLRAILRFLGAGMVMTAT---------
1yvuA2          KGELVRYYLTSYPAFGEKLTEKAIGD-------VFSLLEKLGFKKGSKIVVHRDGRLYR----DEVAAF-
1t06A           DNAFSESKISDMLEMVKDTIHHSPERTKSANFLNTVAISYVAVEIAKEVGIVEVKRDNKKSSLLNASE--
1khbA1          RFCTPASQCPIIDAAWESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAMRSEAKIIMHD----
1rkbA           TASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDH--------------------------------
1qhdA1          ----------------------------------------------------------------------
1urjA           MAVFDEPPTDIEGQDTAAARANAVGAYLARAAGLVGAMVFSTNSALHLTEV-------------------
1jjvA           KLTALCDRILVVDVSPQTQLARSANFEQIQRIMNSQVSQQERLKWADDVINNDAELAQNLPHLQQKVLLH
1jqjA2          GVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFT--SKL------------------------------
1ffhA2          EVLGPDEVLLVLDAMTGQEALSVARAFDEGVTGLVLTKLDGRGGAALSARHVTGKPIYFAGLEPFY----
1grqA           DGAVAEGRETARGDRVAGMAAKQAYVVHEGYDVEVDTTHKESIECAWAIA--------------------
1udwA           ADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQ--
1e9rA           TIATFDDLRGFLEGTLAESLFAGSNEASKTSARFVLSDKLPHVTMPDGDFSIRSWLEDPNGGNLFITWRE
2gx8A1          NKYINQAKFKGADVYVTGDMYYHVAHDAMMLNIVDPGHNVEKVMVQKQLQEKVDAKKLNVHIHASQLHTD
1bgxT2          ELVDLGLARLEVPGYEADDVLASLAKEKEGYEVRILTADKDLYQLSDRIHVLHPEGYLITP--AWLWEKY
1xbtA1          ----------------------------------------------------------------------
1kgdA           PTITPGLNEDESLQRLQKESDILQRTYAHYFDLTIINNEIDTIRHLEEAVEL------------------
1qhlA           KFYRLIELYGGISSAITRSLRDYLLP--------------------------------------------
1pv4A3          DANALHRPKRFFGAARNVEEGGSL---TIIATALIDTGSKXDEVIYEEFKGTGNRKIAEKRVF-------
2yyeA2          GLLFTINKEKLEK------IDETAKELEVNYWIIGE------TIAENVLEVL------------------
2gk3A1          FLLQNETFYQLKIKPNALESIKEYVKNGGGLLXIGGYLSFXGIEAKANYKNTVLAEVLPVIXLDGDDRVE
2v3jA1          RKVTLSFDAPVIRVQDYIEKLDDDESICVFVGAXARGKDNFADEYVDEKVGL--SNYPLSASVACSKFCH
1mjgM           AIVDRVQVTIFTDEAKVKEYMEVAREKYKDDRMRGTDETVDTFYSCVLVCIVTPERVGLCGAVSWLDA--
1zp6A1          VVADLHSQFADLGAFEHHVLPVSGKDTDQALQSAINALQ-------------------------------
1n25A           CLERSEFLLEKRIIQSGIALLLMLIWPVAEFAQSIQSRIVEWKERDKEFSLSVYQKMKFN----------
1ni3A1          DLSIIVDELLIKDAEFVEKHLEGLR--KITSRGANTL---------------------------------
1ii8.1          SLLILDEPTPYLDEERRRKLITMERYLKKIPQVILVSHDEELKDAADHVIRISLENGSSKVE--------
1t3wA           EELIARERTHGLSNEERLELWTLNQELAK-----------------------------------------
1l7lA           ----------------------------------------------------------------------
1o7d.2          VYLVKDPGGKIVPSDVVTIPSSDSQELLFSALVPAVGFSIYSVSQMPRDLVIQNEYLRARFDPNPVRQAF
1i1qA           ----------------------------------------------------------------------
2axpA1          GLHTYSWDTGQWSSDEIAKDIIFL----------------------------------------------
1f46A           GGVVLDDQRRMMTPQKLREYQDIIREVKD-----------------------------------------
1zs3A1          HKFITEDPKAKYWTDEDESFIVDFQAQNMITRAIKLANKEEKFALAAGVVELY-GYNLQV----------
1zbsA1          ---LCEAFLQEYGLTSADIIESVYRKPFPNRFLAGFSPFIAQHLDIPAVYSLVQNFDDFLVRNVLRYNRP
1bs2A1          DFSLLKEPAAKLLIRLLGQYPDVLRNAIKTHEPTTVVTYLFKLT-HQVSSCYDVLWVAGQTEELATARLL
1viaA           ANFILNIENKNIDELLS-EIKKVIK---------------------------------------------
1iioA           EEVADTIVNKA-----------------------------------------------------------
1jb1A           AKSXGYDATKTFEKNLNHLI--------------------------------------------------
1tmkA           DLTLFLSTQFGDERYETVKFQE------KVKQTFMKLLDKEIRKGDESITIVDVTNKGIQEVEALIWQVE
1dnpA2          IALAEKGIPLLFREVDDFVASVEIVCAENSVTHLFYNYQYENERARDVEVERALRNVVCEGFDDSVILPP
1q3tA           ELKIF------LVASVDERAERRYKENIAKGIETDLETLKKEIAARDYK--DSHRETSPLKQAEDAVYLD
1lw7A2          DVTILLK---------------------------------------------------------------
1cd5A           AIMVCDEPSTMELKVKTLRYFNELEAENIK----------------------------------------
1e6cA           EALYQDVAHYVVDAQPPAAIVCELMQ--------------------------------------------
1g6oA           FESLIEGFKDLI-----------------DXIVHINHHKQCDEFY-------------------------
1tljA           VHLLRESNTERVDKDKIKTLVNVCNELARGKQKMNLLKD-------------------------------
1vplA           RLAILDEPTSGLDVLNAREVRKILKQASQEGLTVSSHNMLEVEFLCDRIALIHNGTIVETGTVEELKERY
1j1zA2          NEIGGRHGVGRVDIVENRFVGMKSRGVYEGGTILYHARRAVESLTDREVLHQRDMLSPKYAELVYYGFWY
1pgsA2          ----------------------------------------------------------------------
1c4oA1          VGFVLFPATHYLSPEGLEEILKEIEKELWERVRYFEER--------------------------------
1vhhA           DIIFKDEENTGADRLMTQRCKDKLNALAISGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKY
1d6jA           VEAPYEAPANPNYELPVQDAVKQIIDYLDTKGYLP-AKK-------------------------------
2f9hA1          PTDEDDVIRNGVYLTPH-----QLPKITIGTTIDY-----------------------------------
1s9hA           FKFELTRRLDHDFGKTKQEVKDFFRWAKDHVVEVEHEFYV------------------------------
1f8xA           PTIDLENSYVPLDNQYKGIRVDEHPEYLHDKVWATYNNDLNGIKTNDIMLGVYIPDEEDVGLGMELGYAL
1ckvA           ----------------------------------------------------------------------
2qgmA1          QYVGLGENTHGSSEIFTXKFRLVKYLVTEXGFTNFAXEEDWGNGLKLNEYIQTGKGNPREFLKLLYPTDE
1e3mA2          VHLDAL--------------EHGDTIAFXHSVQDGAASKSYGLAVAALAGVPK--EVIKRAR--------
1afrA           TARQAKEHGDIKLAQICGTIAA-----DEKRHETAYTKIVEKLFEDPDGTVLAFADMMRKKISMPAHLMY
1l1oA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1atrA1          VLRIINEPTAAAIAYGL-----------------------------------------------------
1es6A2          IIPVLLPKYIGLDPVAPGDLTMVITQDCDTHSPAS-----------------------------------
1dhyA1          RIAVQPGELDDLAYAGLEVDDAAARMADKLRQAGVAFTRGDEALMQQRKVMGLLCLQDPFGLPLEIYY--
1mm8A           PELLAIEDTTSLSYRHQVAEELGKLGSIQDKSRGWWVHSVLLLEATFRTVGLLHQEWWMRPDDPADADEK
1ak2A1          HSDDNKKALKIRLEAYHTQTTPLVEYSKRGIHSAIDASQTPDVVFASILAAFS-----------------
1v47A1          -ENLATGAFFPVKGFMTREEALSVAHEMRLPTGEVWTIPILLQFRGNTVALLHGGERVALLHVAEAYELD
1jbkA           QKVFVAEPSVEDTIAI------------------------------------------------------
1sbxA           KRLCLPQILNSVLRDFSLQQINAVCDELHIYCSRCTADQLEILKVXGILPFSPSCGLITKTDAERLCN--
1ohcA1          VIYLGRTPEEAYRGETSYIPFRDAAYGSCNITLLDCFH--------------------------------
1g8yA           LRRFHIENASGPMAQVIGRMEAIAADTGCSIVFLHHAVLVDNIRWQSYLSSMTSAEAEEWGVDDDQRRFF
3cddA1          LIIVNEEVTAEGAAKRGQRSIGKSNXAEYTVTGWRIPQTGKLWNINTLVPVIDEIXGLDEE---------
2ancF1          QKQRHDALISKLLA--------------------------------------------------------
1ckeA           VVFPDAPVKIFLDASSEERAMLQLQVKGFSVNFERLLAEIKLVPAADALVLDSTTLSIE-----------
1cr0A           DVIIL-DHISI-RKMIDNLMTKLKGFAKSTGVVLVVICHLKLRQLSDTIIALERNQLVL-----------
1jqjA3          ----------------------------------------------------------------------
1np6A           PEELVIDRHVIAVASDVPLNL--DVALLDINDVEGLADFVV-----------------------------
1l3aA           ---LPDGSGHFFNLSVQNKLINLDENTKAEFAVLVSAFNFVMPYLLGWHTAVNSFK--------------
1d8jA           KIEVIDGKYAFKPKYNV-----------------------------------------------------
1f2t.1          SLLILDEPTPYLDEERRRKLITIMERYLKKPQVILVSHDEELKDAADHVIRI------------------
1g6hA           KMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVYIDHLYVMFNGQIIAEGRGEEEIK--
1esmA           DILILEGLNVLQSGXDYPHDPHHVFVSDFVDFSVDAPEDLLQTWYINRFLKFREGAFTDPDSYHNYAKLT
1a4iA2          AEILNGK---EISAQIRARLKNQVTQLKEQFTPRLAILQVGNRDDSNLYINVKLKAAEEIGIKATHIKLP
1odfA           DIFILE----------------------------------------------------------------
2fggA1          -LDPADEPVAQIGDELA--IARALSD--LANQLFALTSSDIEAS--------------------------
1yr6A1          SDPEILKKPNDYCFVRFFALLIDL---RLGATTIPALNKVDLLSEEEKERHRKYFEDID--YLTARLKLD
1mi8A           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1xl3C1          DMAIEEEELSELD---------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1bccF           KEVI------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
2vgmA3          YLLLTDKVLHSDNIAQREEYLKLMDSVESNGKALVLSTLHSLGEEDQLTGIA----CILKYPLPDL----
1uouA3          -------------------ADGTVEL-VRALPLALVLHELGALRLVGAELLVDVGQRLRRGTPWLRVHRD
2pa7A1          QEITLDSPAVGLYVGPAVWHE-MHDFSSDCVMMVLASDYYDETDYRQYDNFKKYIAKINL----------
1g8fA3          ----------------------------------------------------------------------
1e2hA           VL--------------------------------------------------------------------
1gm5A1          ---NLPEARKRYRIQKSLEMIEKLR--SWFLIDYL-----------------------------------
1em8A           TFYLLDNDTTVDGLSAVEQLVCEIAAWRSGKRVLIACEDEKAYRLDEALWARPAESFVPHNLAGEGPR--
3cddA2          GVLLTSDTFGNLV---------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1yj5A2          FLEILEIPFRLQEHLDP--ALQRLYRQFSE----------------------------------------
1g31A           YVILVSEPAQAGDEEVTESGLIIGKRQGEVPELC---VVHSGPDVPEGFCEVGDLTSLPVGQ--------
1heiB1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1oy5A           PGVLSEP---------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1w1wA           PFFVLDEVDAALDITNVQRIAAYIRHRNPDLQFIVISLKNTMFEKSDALV--------------------
1b77A2          ----------------------------------------------------------------------
1mkyA1          EPI----PVSAEHNTXLETIIKKLEEKGLD----------------------------------------
2vnuD1          ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1gvnB           ----------------------------------------------------------------------
1do0A           ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1dwmA           --------------KSGNMAAATVERENRNVHAIVEGSAMTKDFRCDRVWVIVNDHGVVTS---------
1dekA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           GWYAQTYQSQQLEMKGEEDAE
2hydA2          ---------------------
1q3hA           PDFSSKLMGYDTFDQFTEERR
1b0uA           SPRLQQFLKGSLK--------
1e69A           ---------------------
1pf4A1          ---------------------
1m3eA1          KIYVH----------------
1l7vC           ---------------------
1pf4A2          ---------------------
1sgwA           ---------------------
1nijA1          NTNGFMLEENVVSTKPRFHFI
1poiA           GMC------------------
1ji0A           ---------------------
1ex6A           ---------------------
2iqhA1          IRGTKVVPRGKLSTRGVQIAS
1bmfA3          SVSRVGSAAQ-----------
1jalA1          NPYLDRVREIAAKEGAV----
1mukA           ---------------------
1yvuA2          ---------------------
1t06A           ---------------------
1khbA1          ---------------------
1rkbA           ---------------------
1qhdA1          ---------------------
1urjA           ---------------------
1jjvA           QFYLQQAENK-----------
1jqjA2          ---------------------
1ffhA2          ---------------------
1grqA           ---------------------
1udwA           ---------------------
1e9rA           DMGPALRPLISAWV-------
2gx8A1          PFI------------------
1bgxT2          G--------------------
1xbtA1          ---------------------
1kgdA           ---------------------
1qhlA           ---------------------
1pv4A3          ---------------------
2yyeA2          ---------------------
2gk3A1          KPE------------------
2v3jA1          GAE------------------
1mjgM           ---------------------
1zp6A1          ---------------------
1n25A           ---------------------
1ni3A1          ---------------------
1ii8.1          ---------------------
1t3wA           ---------------------
1l7lA           ---------------------
1o7d.2          YWYNASTGNNLSSQASGA---
1i1qA           ---------------------
2axpA1          ---------------------
1f46A           ---------------------
1zs3A1          ---------------------
1zbsA1          DLPLHFIGSVAFHYREVLSSV
1bs2A1          YGAARQVLYNGMRLLGLTPVE
1viaA           ---------------------
1iioA           ---------------------
1jb1A           ---------------------
1tmkA           PVLSTHIDHDKFS--------
1dnpA2          GAVMTGNHEMYKVFTPFKNAW
1q3tA           ---------------------
1lw7A2          ---------------------
1cd5A           ---------------------
1e6cA           ---------------------
1g6oA           ---------------------
1tljA           ---------------------
1vplA           KQNIEEVFEEVVK--------
1j1zA2          APERE----------------
1pgsA2          ---------------------
1c4oA1          ---------------------
1vhhA           GMLARLAVEAGFDWVYYES--
1d6jA           ---------------------
2f9hA1          ---------------------
1s9hA           ---------------------
1f8xA           SQGKYVLLVIPDEDYGKPI--
1ckvA           ---------------------
2qgmA1          IIA------------------
1e3mA2          ---------------------
1afrA           DGR------------------
1l1oA           ---------------------
1fl9A           ---------------------
1atrA1          ---------------------
1es6A2          ---------------------
1dhyA1          ---------------------
1mm8A           ESGKWLAAAATSRL-------
1ak2A1          ---------------------
1v47A1          ---------------------
1jbkA           ---------------------
1sbxA           ---------------------
1ohcA1          ---------------------
1g8yA           VRFGVSKANYGAPFADRWFR-
3cddA1          ---------------------
2ancF1          ---------------------
1ckeA           ---------------------
1cr0A           ---------------------
1jqjA3          ---------------------
1np6A           ---------------------
1l3aA           ---------------------
1d8jA           ---------------------
1f2t.1          ---------------------
1g6hA           ---------------------
1esmA           KEEAIKTAXTLWKEINWLNLK
1a4iA2          RTTTESEVMKYITS-------
1odfA           ---------------------
2fggA1          ---------------------
1yr6A1          PSMQGLMAYKMCSMMTE----
1mi8A           ---------------------
1xzpA1          ---------------------
1xl3C1          ---------------------
2je6I3          ---------------------
1bccF           ---------------------
1tueA           ---------------------
2vgmA3          ---------------------
1uouA3          GPALSGPQSRALQ--------
2pa7A1          ---------------------
1g8fA3          ---------------------
1e2hA           ---------------------
1gm5A1          ---------------------
1em8A           ---------------------
3cddA2          ---------------------
1ovmA2          ---------------------
1yj5A2          ---------------------
1g31A           ---------------------
1heiB1          ---------------------
2gtlM1          ---------------------
1oy5A           ---------------------
1t9hA2          ---------------------
1w1wA           ---------------------
1b77A2          ---------------------
1mkyA1          ---------------------
2vnuD1          ---------------------
1p5zB           ---------------------
1gvnB           ---------------------
1do0A           ---------------------
2gujA1          ---------------------
1dwmA           ---------------------
1dekA           ---------------------