[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF56317.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1darA2.bssp"
#ERROR : Can't open dsspfile "1wdtA2.bssp"
#ERROR : Can't open dsspfile "1n0uA2.bssp"
#ERROR : Can't open dsspfile "1f60A3.bssp"
#ERROR : Can't open dsspfile "1o9nA.bssp"
#ERROR : Can't open dsspfile "1aipA3.bssp"
#ERROR : Can't open dsspfile "1nriA.bssp"
#ERROR : Can't open dsspfile "1n0uA1.bssp"
#ERROR : Can't open dsspfile "1fnmA4.bssp"
#ERROR : Can't open dsspfile "1lnzA2.bssp"
#ERROR : Can't open dsspfile "1darA1.bssp"
#ERROR : Can't open dsspfile "1vfgA2.bssp"
#ERROR : Can't open dsspfile "2hgjF1.bssp"
#ERROR : Can't open dsspfile "1h65A.bssp"
#ERROR : Can't open dsspfile "1eniA.bssp"
#ERROR : Can't open dsspfile "1wdtA1.bssp"
#ERROR : Can't open dsspfile "1n0uA4.bssp"
#ERROR : Can't open dsspfile "1aipA1.bssp"
#ERROR : Can't open dsspfile "1upsA2.bssp"
#ERROR : Can't open dsspfile "1r5bA1.bssp"
#ERROR : Can't open dsspfile "1q4rA.bssp"
#ERROR : Can't open dsspfile "1g7rA4.bssp"
#ERROR : Can't open dsspfile "1sulA.bssp"
#ERROR : Can't open dsspfile "1wb1A1.bssp"
#ERROR : Can't open dsspfile "1o94C.bssp"
#ERROR : Can't open dsspfile "1zunB1.bssp"
#ERROR : Can't open dsspfile "1eg7A.bssp"
#ERROR : Can't open dsspfile "1puiA.bssp"
#ERROR : Can't open dsspfile "1g7rA1.bssp"
#ERROR : Can't open dsspfile "1ni3A1.bssp"
#ERROR : Can't open dsspfile "2cxxA1.bssp"
#ERROR : Can't open dsspfile "1mkyA2.bssp"
#ERROR : Can't open dsspfile "1kjzA1.bssp"
#ERROR : Can't open dsspfile "1g7rA2.bssp"
#ERROR : Can't open dsspfile "1h2tC3.bssp"
#ERROR : Can't open dsspfile "1d1nA.bssp"
#ERROR : Can't open dsspfile "1egaA1.bssp"
#ERROR : Can't open dsspfile "2q22A1.bssp"
#ERROR : Can't open dsspfile "1p5uB.bssp"
#ERROR : Can't open dsspfile "2fh5B1.bssp"
#ERROR : Can't open dsspfile "1c82A1.bssp"
#ERROR : Can't open dsspfile "1jxhA.bssp"
#ERROR : Can't open dsspfile "2q22A1.bssp"

## Summary of PDB Search
:514
    6e-53  30%  1darA2 [c.37.1.8] ELONGATION FACTOR G A:1 -- 282
    1e-38  30%  1wdtA2 [c.37.1.8] ELONGATION FACTOR G HOMOLOG A:8 -- 274
    7e-29  22%  1n0uA2 [c.37.1.8] ELONGATION FACTOR 2 A:3 -- 343
    4e-21  19%  1f60A3 [c.37.1.8] ELONGATION FACTOR EEF1A A:2 -- 240
    7e-18   9%  1o9nA  [c.117.1.1] MALONAMIDASE E2
    4e-17  21%  1aipA3 [c.37.1.8] ELONGATION FACTOR TU A:9 -- 212
    3e-16   9%  1nriA  [c.80.1.3] HYPOTHETICAL PROTEIN HI0754
    5e-16  19%  1n0uA1 [b.43.3.1] ELONGATION FACTOR 2 A:344 -- 481
    1e-14  18%  1fnmA4 [d.58.11.1] ELONGATION FACTOR G A:404 -- 482
    2e-14   9%  1lnzA2 [c.37.1.8] SPO0B-ASSOCIATED GTP-BINDING PROTEIN A:158 -- 342
    1e-13  23%  1darA1 [b.43.3.1] ELONGATION FACTOR G A:283 -- 400
    3e-13   7%  1vfgA2 [d.218.1.4] POLY A POLYMERASE A:1 -- 136
    4e-13  10%  2hgjF1 [c.22.1.1] 50S RIBOSOMAL PROTEIN L4 F:3 -- 208
    5e-13   8%  1h65A  [c.37.1.8] CHLOROPLAST OUTER ENVELOPE PROTEIN OEP34
    6e-13   9%  1eniA  [a.18.1.1] ENDONUCLEASE V
    2e-12  23%  1wdtA1 [b.43.3.1] ELONGATION FACTOR G HOMOLOG A:275 -- 377
    2e-12  20%  1n0uA4 [d.58.11.1] ELONGATION FACTOR 2 A:482 -- 560
    3e-12  16%  1aipA1 [b.43.3.1] ELONGATION FACTOR TU A:213 -- 312
    3e-12  13%  1upsA2 [b.42.2.3] GLCNAC-ALPHA-1,4-GAL-RELEASING ENDO-BETA- A:290
    6e-12  17%  1r5bA1 [b.43.3.1] EUKARYOTIC PEPTIDE CHAIN RELEASE FACTOR GTP-
    3e-11  12%  1q4rA  [d.58.4.4] PROTEIN AT3G17210
    3e-11  20%  1g7rA4 [c.37.1.8] TRANSLATION INITIATION FACTOR IF2/EIF5B A:1 --
    3e-11  11%  1sulA  [c.37.1.8] GTP-BINDING PROTEIN YSXC
    1e-10  16%  1wb1A1 [b.43.3.1] TRANSLATION ELONGATION FACTOR SELB A:180 -- 271
    1e-10  10%  1o94C  [c.26.2.3] ELECTRON TRANSFER FLAVOPROTEIN BETA-SUBUNIT
    3e-10  19%  1zunB1 [b.43.3.1] SULFATE ADENYLATE TRANSFERASE, SUBUNIT B:238 --
    1e-09  16%  1eg7A  [c.37.1.10] FORMYLTETRAHYDROFOLATE SYNTHETASE
    2e-09   8%  1puiA  [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGB
    4e-09  13%  1g7rA1 [b.43.3.1] TRANSLATION INITIATION FACTOR IF2/EIF5B A:228 --
    1e-08  10%  1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306
    2e-08  11%  2cxxA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGB A:2 -- 185
    4e-08  15%  1mkyA2 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGA A:173 -- 358
    9e-08  16%  1kjzA1 [b.43.3.1] EIF2GAMMA A:201 -- 321
    5e-07  17%  1g7rA2 [b.43.3.1] TRANSLATION INITIATION FACTOR IF2/EIF5B A:460 --
    1e-06   6%  1h2tC3 [a.118.1.14] 80 KDA NUCLEAR CAP BINDING PROTEIN C:481 -- 790
    2e-06  17%  1d1nA  [b.43.3.1] INITIATION FACTOR 2
    8e-06  10%  1egaA1 [c.37.1.8] PROTEIN (GTP-BINDING PROTEIN ERA) A:4 -- 182
    2e-05  12%  2q22A1 [d.365.1.1] UNCHARACTERIZED PROTEIN A:8 -- 138
    4e-05  11%  1p5uB  [b.2.3.2] F1 CAPSULE ANTIGEN
    9e-05  10%  2fh5B1 [c.37.1.8] SIGNAL RECOGNITION PARTICLE RECEPTOR BETA B:63 --
    1e-04  11%  1c82A1 [a.102.3.2] HYALURONATE LYASE A:171 -- 540
    4e-04   6%  1jxhA  [c.72.1.2] PHOSPHOMETHYLPYRIMIDINE KINASE
    1e-04   8%  2q22A1 [d.365.1.1] UNCHARACTERIZED PROTEIN A:8 -- 138(query 130->178)
:514

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNIQEEIKKRRTFAIISHPDAGKTTITEQLLYFGGEIREAGTVKGKKTGTFAKSDWMDIEKQRGISVTSS
1darA2          VKVEYDLKRLRNIGIAAHIDAGKTTTTERILYYTGR--------------------------------AA
1wdtA2          ----------RTVALVGHAGSGKTTLTEALLYKTGAKERRGRVEEGTTTT----DYTPEAKLHRTTVRTG
1n0uA2          -SLMDKVTNVRNMSVIAHVDHGKSTLTDSLVQRAGIISAGITIKSTAISLY---SEMSDEDVKEIK----
1f60A3          -------KSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKAAELGKGSFKYAWVLDKLKAERERGITIDIA
1o9nA           ------------------------------------------------------LALGTQTGGSVIRPAA
1aipA3          -------KPHVNVGTIGHVDHGKTTLTAALTYVTAAENPTAHVE--------------------------
1nriA           ---EDKLVPLAIESCLPQISLAVEQIVQAFQQGGRLIYIGAGTSGRLGVLDA--SECPPTFGVSTEXVKG
1n0uA1          ----------------------------------------------------------------------
1fnmA4          ----------------------------------------------------------------------
1lnzA2          ----------ADVGLVGFPSVGKSTLLSVVSSAKPKIADYHFTT-----LVPNLGXVETDDGRSFVXADL
1darA1          ----------------------------------------------------------------------
1vfgA2          -------------ILLGKEVWDVDFVVEGNAI---ELAKELARRHGVNVHPFPEFGTAHLKIGKLKLEFA
2hgjF1          -----------------RGTASTKTRGEVAY------------SGRKIWPQKHTGRARHGDIGAPIFVGG
1h65A           -----TFAPATQTKLLELLGNLKQEDVNSLTILVXG--KGGVGKSSTVNSIIGERVVSISPFQSEGPRPV
1eniA           ----------------------------------------------------------------------
1wdtA1          ----------------------------------------------------------------------
1n0uA4          ----------------------------------------------------------------------
1aipA1          ----------------------------------------------------------------------
1upsA2          -------------YLIRNRQTGKFLYIEEN--------NDKVSYGDITLKNEKNAKWSKEYRDGY----T
1r5bA1          ----------------------------------------------------------------------
1q4rA           ----ASFKDGVSPEKIEELIKGYANLVNLIEPXKAFHW--------------GKDVSIENLHQGYTHIFE
1g7rA4          ----------------------------------------------------------------------
1sulA           ---QYPEGGLPEIALAGRSNVGKSSFINSLINRKNLAQTLNFYIINDELHFVDVPGYGFAKVSKS-----
1wb1A1          ----------------------------------------------------------------------
1o94C           ----------------------------------------------------------------------
1zunB1          ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------PFANIAHGCNSIIATKTA
1puiA           ----------MSAPDIRHLPSDTGIEV---------------AFAGRSNAGKSSALNTLTNQQLINLFEV
1g7rA1          ----------------------------------------------------------------------
1ni3A1          -VQWGRPGNNLKTGIVGXPNVGKSTFFRAITKS----VLGNPANYPYATIDPEEAKVAVPDERFDWLCEA
2cxxA1          -----------TIIFAGRSNVGKSTLIYRLTGKKVRRGKRPGVTRKIIEIEWKNHKIIDXPGFGFXXGLP
1mkyA2          ---KPEITDAIKVAIVGRPNVGKSTLFNAILNKERALVSPIPVDDEVFIDGRKYVFVDTAGLEKYSNYRV
1kjzA1          ----------------------------------------------------------------------
1g7rA2          ----------------------------------------------------------------------
1h2tC3          ----------------------------------------------------------------------
1d1nA           ----------------------------------------------------------------------
1egaA1          -----DKSYCGFIAIVGRPNVGKSTLLNKLLGQKISITSRKAQ----TTRHRIVGIHTEGAY--------
2q22A1          ----------------------------------------------------------------------
1p5uB           ----------------------------------------------------------------------
2fh5B1          ----------RAVLFVGLCDSGKTLLFVRLLT----------------------GQYRDTQTSITDSSAI
1c82A1          ------------------------------------------------------DTYTDRLDDWNGIIAG
1jxhA           ----------------------------------------------------------FSALGAYGCSVI
2q22A1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VMQFDYDGKRVNXLDTPGHEDFSEDTYRTLXXXXXXXXXXXXXKGIEAQTXKLFEVVKHRGIPVFTFMNK
1darA2          VTTCFWKDHRINIIDTPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPRIAFANK
1wdtA2          VAPLLFRGHRVFLLDAPGYGDFVGEIRGALEAADAALVAVSAEAGVQVGTERAWTVAERLGLPRMVVVTK
1n0uA2          -QKTDGNSFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTIEGVCVQTETVLRQALGERIKPVVVINK
1f60A3          LWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREGVRQLIVAVNK
1o9nA           YCGTAAIKPSFRMLPTVGVKCYSWALDTVGLFGARAEDLARGLLGRSEFSGIVPAKAPRIGVVRQEFAGA
1aipA3          ---YETAKRHYSHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPIVVFMNK
1nriA           IIAGGECAIRHPVEGAEDNTKAVLNDLQSIHFSKNDVLVGIAASGRTPYVIAGLQYAKSLGALTISIASN
1n0uA1          ----------------------------------------------------------------------
1fnmA4          ----------------------------------------------------------------------
1lnzA2          PGLIEGAHQGVGLGHQFLRHIERTRVIVHVIDXSGLEGRDPYDDYLTINQELSEYNLRLTERPQIIVANK
1darA1          ----------------------------------------------------------------------
1vfgA2          TA-RRETVEPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKDK------------------
2hgjF1          GVVFGPK-PRDYSYTLPKKVRKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDGSESVLL
1h65A           XVSRSRAGFTLNIIDTPGLIEGGYINDXALNIIKSFLLDKTIDVRVDNLDKLVAKAITDSWNKAIVALTH
1eniA           ---------QINLTLVSELADQHLMAEYRELPRVFGAVRKHVANGKRVRDFKISPTFILGAGHVTFFYDK
1wdtA1          ----------------------------------------------------------------------
1n0uA4          ----------------------------------------------------------------------
1aipA1          ----------------------------------------------------------------------
1upsA2          LLKNNETGEYLNIENQTGYIEHGKVPKTWVPVDGYTRFVNRWKPNMSIHTESYEGVLQYGNVPNTYWTSQ
1r5bA1          ----------------------------------------------------------------------
1q4rA           -STFESKEAVAEYIAHPAHVEFATIFLGSL----------------------------------------
1g7rA4          --SIRETLPGLFFIDTPGA--FTTLRKRGGALADLAILIVDINEGFKPQTQEALNILRXYRTPFVVAANK
1sulA           --------------EREAWGRMIETYITTREELKAVVQIVDLRHAPSNDDVQMYEFLKYYGIPVIVIATK
1wb1A1          ----------------------------------------------------------------------
1o94C           ---------------DAIVVGRILTEVIKKEAPDMVFAGVQSSDQAYAST--GISVASYLNWPHAAVVAD
1zunB1          ----------------------------------------------------------------------
1eg7A           LKLADYVVTEAGFGADLGAEKFYDVKCRYVPKSDLATENLEALREGFANLEKHIENIGKFGVPAVVAINA
1puiA           ADGKRLVDLPGYGEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHPLKDLDQQMIEWAVDSNIAVLVLLTK
1g7rA1          ----------------------------------------------------------------------
1ni3A1          YKPKSRVPAFLTVFDIAGLSTGVGLGNAFLSHVRAVDAIYQVVRAFDDAEIIHVEGDVDPIRDLSIIVDE
2cxxA1          KEVQERIKDEIVHFIEDNAKNIDVAVLVVDGKAAPEIIKRWEKRGEIPIDVEFYQFLRELDIPTIVAVNK
1mkyA2          VDSIEKADVVVIVLDATQGITR--------------------------QDQRXAGLXERRGRASVVVFNK
1kjzA1          ----------------------------------------------------------------------
1g7rA2          ----------------------------------------------------------------------
1h2tC3          ----------------------------------------------------------------------
1d1nA           ----------------------------------------------------------------------
1egaA1          -QAIYVDTPGLHMEEKRAINRLMNKAASSSIGDVELVIFVVEGTRWTPDDEMVLNKLREGKAPVILAVNK
2q22A1          ----------------------------------------------------------------------
1p5uB           ----------------------------------------------------------------------
2fh5B1          YKVNNNRGNSLTLIDPGHESLRFQLLDRFKSSARAVVFVVDSAAFQREVKDVIDSMALKNSPSLLIACNK
1c82A1          NQYYDSQMAKLNQELEGKVADS------------------------------------------------
1jxhA           TALVAENTCGVQSVYRIEPDFVAAQLDSVFSDVRIDTTKIGMLAETDIVEAVAERLQRHHVRNVVLDTVM
2q22A1          -----------------------------------------------------------ILNKFNCLDIA


                         +         .         .         .         .         *         .:210
query           LDRDGREPLDLLQELEEILGIASYPMNWPIGMGKAFEGLYDLYNQRLELYKGDERFASLEDGDKLFGSNP
1darA2          MDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDVLRMKAYTYGND----LGTDIREIPIPEE
1wdtA2          LDKGGDYYALLEDLRSTLGPI--LPIDLPLYEGGKWVGLIDVFHGKAYRENGEEREAEVEERERV---QR
1n0uA2          VDRALLELQVSKEDLYQTFAVSTYPARGTVAFGSGLHGWAFTIRQFATRYAKKFGVDKAKMMDRLWGDSF
1f60A3          MDSVKWDESRFQEIVKETSNVGYNPKTVPFVPISGWNGDNMIEATTNAPWWEKETKAGVVKGKTLL----
1o9nA           VEPAAEQGLQAAIKAAERAGASVQAIDLPEAVHEAWRIHPII----------------------------
1aipA3          VDMVDDPEDLVEMEVRDLLNQYEFPGEVPVIRGSALLALEQMHRNPKTRRGENEWVDKIWE---------
1nriA           PKSEXAEIADIAIETIVGPEI--LTGSSRLKSGTAQKXVLNXLTTASXILLGKCYENLXVD---------
1n0uA1          ----------------------------------------------------------------------
1fnmA4          ----------------------------------------------------------------------
1lnzA2          XDXPEAAENLEAFKEKLTDDYPVFPISTREGLRELLFEVANQLENTPEFPLYDEE---------------
1darA1          ----------------------------------------------------------------------
1vfgA2          ----------------------------------------------------------------------
2hgjF1          VTGNRNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWEVFQNRIG--------------------------
1h65A           AQFSPPDGLPYDEFFSKRSEALLQVVRSGAS----LKKDAQASDIPVVLIENSGRCNKNDSDEKVLPGIA
1eniA           LEFLRKRQIELIAECLKRGFNIKDTTVQDISDIPQEFRGDYIPHEASIAISQARLDEKIA----------
1wdtA1          ----------------------------------------------------------------------
1n0uA4          ----------------------------------------------------------------------
1aipA1          ----------------------------------------------------------------------
1upsA2          WQLIPVE---------------------------------------------------------------
1r5bA1          ----------------------------------------------------------------------
1q4rA           ----------------------------------------------------------------------
1g7rA4          IDR-------------------------------------------------------------------
1sulA           ADKIPKGKWDKHAKVVRQTLNIDPEDELILFSSETKKGKDEAWGAIKKMIN-------------------
1wb1A1          ----------------------------------------------------------------------
1o94C           LQYKPGDNKAVIRRELEGGMLQEVEINCPAVLTGINKPRYASLRGIKQAATKPIEEVSLADIG-------
1zunB1          ----------------------------------------------------------------------
1eg7A           FPTDTEAELNLLYELCAKAGAEVALSWAKGGEGELARKVLQTLESRPSNFHVLYN----LDLSIKDKIAK
1puiA           ADKASGARKAQLNMVREAVLAFNGDVQVETFSSLKKQGVDKLRQKLDTWF--------------------
1g7rA1          ----------------------------------------------------------------------
1ni3A1          LLIKDAEFVKHLEGLRKI----------------------------------------------------
2cxxA1          LDKIKNVQEVINFLAEKFEVPLSEIDKVGDNIERLKNRIFEVIRER------------------------
1mkyA2          WDLVVHREKRYDEFTKLFREKLYFIDYSPLIFADKGWNIDRXIDAXNLAYAS------------------
1kjzA1          ----------------------------------------------------------------------
1g7rA2          ----------------------------------------------------------------------
1h2tC3          ----------------------------------------------------------------------
1d1nA           ----------------------------------------------------------------------
1egaA1          VDNVQEKADLLPHLQFLASQMNFLDIVPGLNVDTIAAIVRKHLPEA------------------------
2q22A1          ----------------------------------------------------------------------
1p5uB           ----------------------------------------------------------------------
2fh5B1          QDIAMAKS---AKLIQQQLEKELNTLRVTRSPAQLGKKGKEFEFSQLPL---------------------
1c82A1          ----------------------------------------------------------------------
1jxhA           LLLSPSAIETLRVRLLP-----------------------------------------------------
2q22A1          PILKPSEKESVRRALILITKLSDYQILGICADTADEGL--------------------------------


                         .         .         .         +         .         .         .:280
query           FYEQVKDDIELLNEAGNEFSEEAILAGELTPVFFGSALTNFGVQTFLETFLKFAPEPHGHKKTDGEIVDP
1darA2          YLDQAREYHEKLVEVAADFDENGTIDLKITPVFLGSALKNKGVQLLLDAVVDYLP---------------
1wdtA2          FRQEVLEAIEVTGEALEKAFHEAVRRGLLYPVALASGEREIGVLPLLELILEALP---------------
1n0uA2          FNPKTKKWTNKDTDAEGKPLERA-----------------------------------------------
1f60A3          ----------------------------------------------------------------------
1o9nA           ----------------------------------------------------------------------
1aipA3          ----------------------------------------------------------------------
1nriA           ----------------------------------------------------------------------
1n0uA1          ----------------------------------AQAYRAEQLYEGPADDANCIAIKN----------CD
1fnmA4          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1darA1          ---------------------------------------------------------------EGEVVEI
1vfgA2          ----------------------------------------------------------------------
2hgjF1          ----------------------------------------------------------------------
1h65A           WIPHLVQTIEVALNKSESI---------------------------------------------------
1eniA           ----------------------------------------------------------------------
1wdtA1          ---------------------------------------------------------------------F
1n0uA4          ----------------------------------------------------------------------
1aipA1          ---------------------------------------------------------------------P
1upsA2          ----------------------------------------------------------------------
1r5bA1          ----------------------------------------------------------------------
1q4rA           ----------------------------------------------------------------------
1g7rA4          ----------------------------------------------------------------------
1sulA           ----------------------------------------------------------------------
1wb1A1          ----------------------------------------------------------------------
1o94C           ----------------------------------------------------------------------
1zunB1          --------------------------------------------------------------------DR
1eg7A           IATEIYDGVNYTAEADKAIQRYESLGYGNLPVVMAKTQYSFSDDM------TKLGRPRNFTITVREVRLS
1puiA           ----------------------------------------------------------------------
1g7rA1          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1mkyA2          ----------------------------------------------------------------------
1kjzA1          ---------------------------------------------------------------------D
1g7rA2          ----------------------------------------------------------------------
1h2tC3          --ATNDEIFSILKDVPNPSFNPLKIEVFVQTLLHLAAKSFSHSFSALAKFHEVFKTLAESD---------
1d1nA           ----------------------------------------------------------------------
1egaA1          ----------------------------------------------------------------------
2q22A1          -KESVRRALILITKLSDY--------QILGICADTADEGLLAXKTYSHALGYEVPDLPVV------EGPV
1p5uB           ------------------------------------------------------------------MYLT
2fh5B1          ----------------------------------------------------------------------
1c82A1          ----------------------------------------------------------------------
1jxhA           ----------------------------------------------------------------------
2q22A1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           YDKDFSGFVFKIQANMDPRHRDRIAFVRIVSGEFERGMSVNLPRTGKGAKLSNVTQFMAESRENVINAVA
1darA2          ----------------------------------------------------------------------
1wdtA2          ----------------------------------------------------------------------
1n0uA2          ----------------------------------------------------------------------
1f60A3          ----------------------------------------------------------------------
1o9nA           ----------------------------------------------------------------------
1aipA3          ----------------------------------------------------------------------
1nriA           ----------------------------------------------------------------------
1n0uA1          PKADLMLYVSKMVPTSDKGR--FYAFGRVFAGTVKSGQKVRIQGPNYVPAIQRVVLMMGRFVEPIDDCPA
1fnmA4          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1darA1          HPDPNGPLAALAFKIMADPYVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHANHREEVEELKA
1vfgA2          ----------------------------------------------------------------------
2hgjF1          ----------------------------------------------------------------------
1h65A           ----------------------------------------------------------------------
1eniA           ----------------------------------------------------------------------
1wdtA1          GDGPPLAKVFKV---QVDPFMGQVAYLRLYRGRLKPGDSLQSEAGQV--RLPHLYVPMGKDLLEVEEAEA
1n0uA4          ----------------------------------------------------------------------
1aipA1          VRDVDKPFLMPVEDVFTITGRGTVATGRIERGKVKVGDEVEIVGLAPETRRTVVTGVRKTLQEGIAGDNV
1upsA2          ----------------------------------------------------------------------
1r5bA1          ---------FIMPIASKYKDLGTILEGKIEAGSIKKNSNVLVMPINQTLEVTAIYDEADEEISSSICGDQ
1q4rA           ----------------------------------------------------------------------
1g7rA4          ----------------------------------------------------------------------
1sulA           ----------------------------------------------------------------------
1wb1A1          -------FKMPLDHAFPIKGAGTVVTGTINKGIVKVGDELKVLPINMSTKVRSIQYFKESVMEAKAGDRV
1o94C           ----------------------------------------------------------------------
1zunB1          NYTDLRFPVQYV---NRPNLNFRGFAGTLASGIVHKGDEIVVLPSGKSSRVKSIVTF----EGELEQAGP
1eg7A           AGG---RLIVPITGAIMPGLPKRPAACNID----------------------------------------
1puiA           ----------------------------------------------------------------------
1g7rA1          -DSPARGTILEVKE---ETGLGXTIDAVIYDGILRKDDTIAXXTSKDVISIRSLLKPRPLKFQKVDEVVA
1ni3A1          ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1mkyA2          ----------------------------------------------------------------------
1kjzA1          PNKPPKMLVLRSDVNKPGKLVGGVLDGSIVQGKLKVGDEIEIRPGVKYEPITTEIVSLQAGGQFVEEAYP
1g7rA2          -IKPAS-IRLIPKLVFRQS-KPAIGGVEVLTGVIRQGYPLXNDDGETVGTVESXQDKGENLKSASRQKVA
1h2tC3          -EGKLHVLRVMFEVWRNHPQMIAVLVDKMIRTQIVDCAAVANFTRLFVWEILHSTIRKMNKHVGAQSEQK
1d1nA           YEEKVIGQ-AEVRQTFKVSKVGTIAGCYVTDGKITRDSKVRLIRQGIVVYEGEIDSLKRY-KDDVREVAQ
1egaA1          ----------------------------------------------------------------------
2q22A1          YIKLNGKNGLCYLDSYAGHHRGVLVSCQSYYEGGINEXYGHLP---------------------------
1p5uB           FTSQDGNNHQFTTKVIGK-DSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSK----GGKLAAGKY
2fh5B1          ----------------------------------------------------------------------
1c82A1          ----------------------------------------------------------------------
1jxhA           ----------------------------------------------------------------------
2q22A1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GDIIGVYDTGTYQVGDTLTVGKNKFEFEPLPTFTPEIFMKVSAKNVMKQKSFHKGIEQLVQEGAIQLYKN
1darA2          ----------------------------------------------------------------------
1wdtA2          ----------------------------------------------------------------------
1n0uA2          ----------------------------------------------------------------------
1f60A3          ----------------------------------------------------------------------
1o9nA           ----------------------------------------------------------------------
1aipA3          ----------------------------------------------------------------------
1nriA           ----------------------------------------------------------------------
1n0uA1          GNIIGVGIDQFLLKTGTLTTSETAHNMKVM----------------------------------------
1fnmA4          ----------------------------------PVIDVAIEPKTKADQEKLSQALARLAEEDPFRVSTH
1lnzA2          ----------------------------------------------------------------------
1darA1          GDLGAVVGLKETITGDTLVGEDAP---RVIL---------------------------------------
1vfgA2          ----------------------------------------------------------------------
2hgjF1          ----------------------------------------------------------------------
1h65A           ----------------------------------------------------------------------
1eniA           ----------------------------------------------------------------------
1wdtA1          GFVLGVPKAEGLHRGMVLWQGEKP-ESEEVPFA-------------------------------------
1n0uA4          ---------------------------------SPVVQVAVEVKNANDLPKLVEGLKRLSKSDPCVLTYM
1aipA1          GVLLRGVSREEVERGQVLAKPGS-----------------------------------------------
1upsA2          ----------------------------------------------------------------------
1r5bA1          VRLRVRGDDSDVQTGYVLTSTKN-----------------------------------------------
1q4rA           ----------------------------------------------------------------------
1g7rA4          ----------------------------------------------------------------------
1sulA           ----------------------------------------------------------------------
1wb1A1          GMAIQGVDAKQIYRGXILT---------------------------------------------------
1o94C           ----------------------------------------------------------------------
1zunB1          GQAVTLTXEDDISRGDLLVHADN-----------------------------------------------
1eg7A           ----------------------------------------------------------------------
1puiA           ----------------------------------------------------------------------
1g7rA1          AAGIKIPGIDDVXAGSPLRV--------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1mkyA2          ----------------------------------------------------------------------
1kjzA1          GGLVGVLTKGDLMAGNVVGKPGK-----------------------------------------------
1g7rA2          XAIKDAVYGKTIHEGDTLYVDIP-----------------------------------------------
1h2tC3          NLFLVIFQRFIMILTEHLVRCETDGTSVLTPWY-------------------------------------
1d1nA           GYECGLTIKNDIKEGDVIEA--------------------------------------------------
1egaA1          ----------------------------------------------------------------------
2q22A1          ----------------------------------------------------------------------
1p5uB           TDAVTV----------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------
1c82A1          ----------------------------------------------------------------------
1jxhA           ----------------------------------------------------------------------
2q22A1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           YQTGEYMLGAVGQLQFEVFKHRMEGEYNAEVVMNPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1darA2          ----------------------------------------------------------------------
1wdtA2          ----------------------------------------------------------------------
1n0uA2          ----------------------------------------------------------------------
1f60A3          ----------------------------------------------------------------------
1o9nA           ----------------------------------------------------------------------
1aipA3          ----------------------------------------------------------------------
1nriA           ----------------------------------------------------------------------
1n0uA1          ----------------------------------------------------------------------
1fnmA4          PETGQTIISGMGELHLEIIVDRLKREFKVDANVGK-----------------------------------
1lnzA2          ----------------------------------------------------------------------
1darA1          ----------------------------------------------------------------------
1vfgA2          ----------------------------------------------------------------------
2hgjF1          ----------------------------------------------------------------------
1h65A           ----------------------------------------------------------------------
1eniA           ----------------------------------------------------------------------
1wdtA1          ----------------------------------------------------------------------
1n0uA4          SESGEHIVAGTGELHLEICLQDLEHDHA------------------------------------------
1aipA1          ----------------------------------------------------------------------
1upsA2          ----------------------------------------------------------------------
1r5bA1          ----------------------------------------------------------------------
1q4rA           ----------------------------------------------------------------------
1g7rA4          ----------------------------------------------------------------------
1sulA           ----------------------------------------------------------------------
1wb1A1          ----------------------------------------------------------------------
1o94C           ----------------------------------------------------------------------
1zunB1          ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1puiA           ----------------------------------------------------------------------
1g7rA1          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1mkyA2          ----------------------------------------------------------------------
1kjzA1          ----------------------------------------------------------------------
1g7rA2          ----------------------------------------------------------------------
1h2tC3          ----------------------------------------------------------------------
1d1nA           ----------------------------------------------------------------------
1egaA1          ----------------------------------------------------------------------
2q22A1          ----------------------------------------------------------------------
1p5uB           ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------
1c82A1          ----------------------------------------------------------------------
1jxhA           ----------------------------------------------------------------------
2q22A1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxx
1darA2          ------------------------
1wdtA2          ------------------------
1n0uA2          ------------------------
1f60A3          ------------------------
1o9nA           ------------------------
1aipA3          ------------------------
1nriA           ------------------------
1n0uA1          ------------------------
1fnmA4          ------------------------
1lnzA2          ------------------------
1darA1          ------------------------
1vfgA2          ------------------------
2hgjF1          ------------------------
1h65A           ------------------------
1eniA           ------------------------
1wdtA1          ------------------------
1n0uA4          ------------------------
1aipA1          ------------------------
1upsA2          ------------------------
1r5bA1          ------------------------
1q4rA           ------------------------
1g7rA4          ------------------------
1sulA           ------------------------
1wb1A1          ------------------------
1o94C           ------------------------
1zunB1          ------------------------
1eg7A           ------------------------
1puiA           ------------------------
1g7rA1          ------------------------
1ni3A1          ------------------------
2cxxA1          ------------------------
1mkyA2          ------------------------
1kjzA1          ------------------------
1g7rA2          ------------------------
1h2tC3          ------------------------
1d1nA           ------------------------
1egaA1          ------------------------
2q22A1          ------------------------
1p5uB           ------------------------
2fh5B1          ------------------------
1c82A1          ------------------------
1jxhA           ------------------------
2q22A1          ------------------------