[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF56337.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1j5xA.bssp"
#ERROR : Can't open dsspfile "1jeoA.bssp"
#ERROR : Can't open dsspfile "1b0zA.bssp"
#ERROR : Can't open dsspfile "2o3fA1.bssp"
#ERROR : Can't open dsspfile "1tzbA.bssp"
#ERROR : Can't open dsspfile "1dqrA.bssp"
#ERROR : Can't open dsspfile "1jxaA1.bssp"
#ERROR : Can't open dsspfile "1tk9A.bssp"

## Summary of PDB Search
:269
    2e-15  18%  1j5xA  [c.80.1.1] GLUCOSAMINE-6-PHOSPHATE DEAMINASE
    4e-14  17%  1jeoA  [c.80.1.3] HYPOTHETICAL PROTEIN MJ1247
    2e-13  11%  1b0zA  [c.80.1.2] PROTEIN (PHOSPHOGLUCOSE ISOMERASE)
    2e-10  19%  2o3fA1 [a.4.1.20] PUTATIVE HTH-TYPE TRANSCRIPTIONAL REGULATOR
    6e-09  27%  1tzbA  [c.80.1.1] GLUCOSE-6-PHOSPHATE ISOMERASE, CONJECTURAL
    2e-08  24%  1dqrA  [c.80.1.2] PHOSPHOGLUCOSE ISOMERASE
    4e-06  22%  1jxaA1 [c.80.1.1] GLUCOSAMINE 6-PHOSPHATE SYNTHASE A:241 -- 608
    7e-04  33%  1tk9A  [c.80.1.3] PHOSPHOHEPTOSE ISOMERASE 1
:269

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxLIPMIEANLPNMAYAEKDIAKFFLKQQPLNDYSSKALCEYLNVSKATLTRFAKKCGFKGFRQFI
1j5xA           ----------------------------------------------------------------------
1jeoA           ----------------------------------------------------------------------
1b0zA           -------------------------------------------------------SFDYSNALPFMQENE
2o3fA1          ------GLAIIQSXXHXLPPSERKLADYILAHHXAIESTVNEISALANSSDAAVIRLCXSLGLKGFQDL-
1tzbA           ----------------------------------------------------------------------
1dqrA           ---------------------------------------------LLDYSKNLVTDLAKSRGVEAARESM
1jxaA1          ----------------------------------------------------------------IYRHYM
1tk9A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FKYQEMIHEKEKLALYTEATEKVLSDYEEMLRKTYTVLDEVQLERIAEMIETAERVYLYGKGSSVLALQE
1j5xA           ------------------------SKTLKEITDQKNELKKFFENFVLNLEKITDEVLFVGCGSSYNLALT
1jeoA           --------------------DIVSNNILILKKFYTNDEWKNKLDSLIDRIIKAKKIFIFGVGRSGYIGRC
1b0zA           LDYLSEFVKAAHHML-HERKGSDFLGWVDWPIRYDKNEFSRIKQAAERIRNHSDALVVIGIGGSYLGARA
2o3fA1          ----------------------------------------------------------------------
1tzbA           ---------------------QLLQDYLNILRRVDFPTSYV-VEGEVVRIEAMPRLYISGMGGSGVVADL
1dqrA           FN-GEKINSTEDRALRNRSNTPIVVDGKDVMPEVNKVLDKMKGDWKGYTGKTITDVINIGIGGSDLGVTE
1jxaA1          QKE---IYEQP------NAIKNTLTGRISHGQVDLSELGPN----ADELLSKVEHIQILACGTSYNSGMV
1tk9A           ---------------------------------------EILKGQIAKVGELLCECLKKGGGSAADAQHE


                         +         .         .         .         .         *         .:210
query           MKMRFMRLGVIGEVLSDEDMILWSSLLLNENCLVIGASISGQTDIVLEGLQKAADKGAKTVLMTTRKXXX
1j5xA           ISYYFERVLKIRKAIPAGEVAFQKIPDLEERGLAFLFSRTGNTTEVLLANDVLKKRNHRTIGIT------
1jeoA           FAMRLMHLGFKSYFVGETTT-----PSYEKDDLLILISGSGRTESVLT-VAKKAKNINNNIIAIVXEXGN
1b0zA           AIEALSHTFHNGQNISSTYISHLLDVLEGKDLSINVISKSGTTTEPAIAFRIFRDYMEKKYGKE------
2o3fA1          ----------------------------------------------------------------------
1tzbA           IRDFSLTWNWEVEVIAVKDYFLKAR-----DGLLIAVSYSGNTIETLYTVEYAKRRRIPAVAITT-----
1dqrA           ALKPYSSGGPRVWFVSNIDIAKTLACLNPESSLFIIASKTFTTQETITNAKTAKDWFLLSAK--------
1jxaA1          SRYWFESLGIPCDVEIASEFRYRKSAV-RRNSLMITLSQSGETADTLAGLRLSKELGYLGSLAIC-----
1tk9A           LSGRYKRKALAGIALTTDTSALQVEALGNEKDVLIGISTSGKSPNVLEALKKA-----------------


                         .         .         .         +         .         .         .:280
query           XXXXXXXXXXXASTDHLSYGNRISPQFPILLITDCLFxxxxxxxxxxxxxxxxxxxxxx
1j5xA           -----------------------------------------------------------
1jeoA           VVEFADLTIPLEVKKSKYLPMGTTFEETALIFLDLVI----------------------
1b0zA           -----------------------------------------------------------
2o3fA1          -----------------------------------------------------------
1tzbA           -----------------------------------------------------------
1dqrA           -----------------------------------------------------------
1jxaA1          -----------------------------------------------------------
1tk9A           -----------------------------------------------------------