[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF56378.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "1mukA.bssp"
#ERROR : Can't open dsspfile "1m3eA1.bssp"
#ERROR : Can't open dsspfile "1pf4A1.bssp"
#ERROR : Can't open dsspfile "2yyeA2.bssp"
#ERROR : Can't open dsspfile "1ex6A.bssp"
#ERROR : Can't open dsspfile "1qhlA.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "2gk3A1.bssp"
#ERROR : Can't open dsspfile "1khbA1.bssp"
#ERROR : Can't open dsspfile "1urjA.bssp"
#ERROR : Can't open dsspfile "1mjgM.bssp"
#ERROR : Can't open dsspfile "1nijA1.bssp"
#ERROR : Can't open dsspfile "1ohcA1.bssp"
#ERROR : Can't open dsspfile "1bmfA3.bssp"
#ERROR : Can't open dsspfile "1pv4A3.bssp"
#ERROR : Can't open dsspfile "1c4oA1.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "2v3jA1.bssp"
#ERROR : Can't open dsspfile "1tljA.bssp"
#ERROR : Can't open dsspfile "2iqhA1.bssp"
#ERROR : Can't open dsspfile "1jalA1.bssp"
#ERROR : Can't open dsspfile "1es6A2.bssp"
#ERROR : Can't open dsspfile "1t06A.bssp"
#ERROR : Can't open dsspfile "1xbtA1.bssp"
#ERROR : Can't open dsspfile "1f46A.bssp"
#ERROR : Can't open dsspfile "1kgdA.bssp"
#ERROR : Can't open dsspfile "1zp6A1.bssp"
#ERROR : Can't open dsspfile "1i1qA.bssp"
#ERROR : Can't open dsspfile "1jjvA.bssp"
#ERROR : Can't open dsspfile "1jb1A.bssp"
#ERROR : Can't open dsspfile "2axpA1.bssp"
#ERROR : Can't open dsspfile "1rkbA.bssp"
#ERROR : Can't open dsspfile "1l3aA.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"
#ERROR : Can't open dsspfile "1f2t.1.bssp"
#ERROR : Can't open dsspfile "1poiA.bssp"
#ERROR : Can't open dsspfile "1s9hA.bssp"
#ERROR : Can't open dsspfile "1t3wA.bssp"
#ERROR : Can't open dsspfile "1ovmA2.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1fl9A.bssp"
#ERROR : Can't open dsspfile "1g6oA.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "1bgxT2.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "3cddA1.bssp"
#ERROR : Can't open dsspfile "2gx8A1.bssp"
#ERROR : Can't open dsspfile "1j1zA2.bssp"
#ERROR : Can't open dsspfile "1mi8A.bssp"
#ERROR : Can't open dsspfile "1ffhA2.bssp"
#ERROR : Can't open dsspfile "2qgmA1.bssp"
#ERROR : Can't open dsspfile "1cd5A.bssp"
#ERROR : Can't open dsspfile "1zs3A1.bssp"
#ERROR : Can't open dsspfile "1udwA.bssp"
#ERROR : Can't open dsspfile "1b77A2.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "1jbkA.bssp"
#ERROR : Can't open dsspfile "1w1wA.bssp"
#ERROR : Can't open dsspfile "2f9hA1.bssp"
#ERROR : Can't open dsspfile "1e3mA2.bssp"
#ERROR : Can't open dsspfile "2fggA1.bssp"
#ERROR : Can't open dsspfile "1ak2A1.bssp"
#ERROR : Can't open dsspfile "1dhyA1.bssp"
#ERROR : Can't open dsspfile "1atrA1.bssp"
#ERROR : Can't open dsspfile "1np6A.bssp"
#ERROR : Can't open dsspfile "3cddA2.bssp"
#ERROR : Can't open dsspfile "1viaA.bssp"
#ERROR : Can't open dsspfile "1bs2A1.bssp"
#ERROR : Can't open dsspfile "1o7d.2.bssp"
#ERROR : Can't open dsspfile "2gtlM1.bssp"
#ERROR : Can't open dsspfile "2vgmA3.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1gm5A1.bssp"
#ERROR : Can't open dsspfile "1l7lA.bssp"
#ERROR : Can't open dsspfile "2gujA1.bssp"
#ERROR : Can't open dsspfile "1qhdA1.bssp"
#ERROR : Can't open dsspfile "1mm8A.bssp"
#ERROR : Can't open dsspfile "2vnuD1.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "1g8yA.bssp"
#ERROR : Can't open dsspfile "1t9hA2.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "1vhhA.bssp"
#ERROR : Can't open dsspfile "1v47A1.bssp"
#ERROR : Can't open dsspfile "2pa7A1.bssp"
#ERROR : Can't open dsspfile "2ancF1.bssp"
#ERROR : Can't open dsspfile "1ni3A1.bssp"
#ERROR : Can't open dsspfile "1ii8.1.bssp"
#ERROR : Can't open dsspfile "2je6I3.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "1yvuA2.bssp"
#ERROR : Can't open dsspfile "1jqjA3.bssp"
#ERROR : Can't open dsspfile "1v37A.bssp"
#ERROR : Can't open dsspfile "1puoA2.bssp"
#ERROR : Can't open dsspfile "1yj5A2.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1g8fA3.bssp"
#ERROR : Can't open dsspfile "1odfA.bssp"
#ERROR : Can't open dsspfile "1l1oA.bssp"
#ERROR : Can't open dsspfile "1iqrA2.bssp"
#ERROR : Can't open dsspfile "1tmkA.bssp"
#ERROR : Can't open dsspfile "1dnpA2.bssp"
#ERROR : Can't open dsspfile "1jqjA2.bssp"
#ERROR : Can't open dsspfile "1f8xA.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1mkyA1.bssp"
#ERROR : Can't open dsspfile "1zbsA1.bssp"
#ERROR : Can't open dsspfile "1xl3C1.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "1iioA.bssp"
#ERROR : Can't open dsspfile "1em8A.bssp"
#ERROR : Can't open dsspfile "1oa8A.bssp"
#ERROR : Can't open dsspfile "2bsqE1.bssp"
#ERROR : Can't open dsspfile "1j90A.bssp"
#ERROR : Can't open dsspfile "1esmA.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "1tueA.bssp"
#ERROR : Can't open dsspfile "1sbxA.bssp"
#ERROR : Can't open dsspfile "1q3tA.bssp"
#ERROR : Can't open dsspfile "1a4iA2.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "1lnzA2.bssp"
#ERROR : Can't open dsspfile "1uouA3.bssp"

## Summary of PDB Search
:210
    8e-38  29%  1b0uA  [c.37.1.12] HISTIDINE PERMEASE
    6e-34  25%  1sgwA  [c.37.1.12] PUTATIVE ABC TRANSPORTER
    4e-33  20%  1ji0A  [c.37.1.12] ABC TRANSPORTER
    2e-32  22%  1q3hA  [c.37.1.12] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-29  27%  1l7vC  [c.37.1.12] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    3e-28  18%  1e69A  [c.37.1.12] CHROMOSOME SEGREGATION SMC PROTEIN
    4e-28  13%  1mukA  [e.8.1.4] MINOR CORE PROTEIN LAMBDA 3
    6e-27  11%  1m3eA1 [c.124.1.2] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
    8e-26  26%  1pf4A1 [c.37.1.12] TRANSPORT ATP-BINDING PROTEIN MSBA A:321 -- 564
    9e-25  13%  2yyeA2 [d.139.1.1] SELENIDE, WATER DIKINASE A:155 -- 336
    2e-24  11%  1ex6A  [c.37.1.1] GUANYLATE KINASE
    4e-24  18%  1qhlA  [c.37.1.12] PROTEIN (CELL DIVISION PROTEIN MUKB)
    6e-22   7%  1e9rA  [c.37.1.11] CONJUGAL TRANSFER PROTEIN TRWB
    1e-21  10%  2gk3A1 [c.23.16.9] PUTATIVE CYTOPLASMIC PROTEIN A:8 -- 253
    2e-21  11%  1khbA1 [c.91.1.1] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    4e-21   9%  1urjA  [e.58.1.1] MAJOR DNA-BINDING PROTEIN
    6e-21  14%  1mjgM  [e.26.1.3] CARBON MONOXIDE DEHYDROGENASE ALPHA SUBUNIT
    3e-20  13%  1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223
    4e-20   7%  1ohcA1 [c.45.1.1] CDC14B2 PHOSPHATASE A:42 -- 198
    1e-19  10%  1bmfA3 [c.37.1.11] BOVINE MITOCHONDRIAL F1-ATPASE A:95 -- 379
    2e-19   9%  1pv4A3 [c.37.1.11] TRANSCRIPTION TERMINATION FACTOR RHO A:129 --
    9e-19  11%  1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:2
    2e-18  11%  1e6cA  [c.37.1.2] SHIKIMATE KINASE
    4e-18   9%  2v3jA1 [c.116.1.6] ESSENTIAL FOR MITOTIC GROWTH 1 A:23 -- 251
    4e-18   6%  1tljA  [d.282.1.1] HYPOTHETICAL UPF0130 PROTEIN SSO0622
    6e-18  10%  2iqhA1 [e.75.1.1] NUCLEOCAPSID PROTEIN A:21 -- 489
    8e-18  10%  1jalA1 [c.37.1.8] YCHF PROTEIN A:1 -- 278
    8e-18  12%  1es6A2 [b.31.1.1] MATRIX PROTEIN VP40 A:201 -- 321
    1e-17   7%  1t06A  [a.118.1.17] HYPOTHETICAL PROTEIN
    2e-17  14%  1xbtA1 [c.37.1.24] THYMIDINE KINASE, CYTOSOLIC A:18 -- 150
    3e-17   9%  1f46A  [d.129.4.1] CELL DIVISION PROTEIN ZIPA
    4e-17   9%  1kgdA  [c.37.1.1] PERIPHERAL PLASMA MEMBRANE CASK
    4e-17  12%  1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181
    6e-17  16%  1i1qA  [d.161.1.1] ANTHRANILATE SYNTHASE COMPONENT I
    9e-17  13%  1jjvA  [c.37.1.1] DEPHOSPHO-COA KINASE
    1e-16  11%  1jb1A  [c.91.1.2] HPRK PROTEIN
    2e-16  12%  2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165
    2e-16  11%  1rkbA  [c.37.1.1] PROTEIN AD-004
    3e-16  11%  1l3aA  [d.18.1.2] P24: PLANT TRANSCRIPTIONAL REGULATOR PBF-2
    3e-16   8%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
    7e-16  21%  1f2t.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    1e-15   9%  1poiA  [c.124.1.2] GLUTACONATE COENZYME A-TRANSFERASE
    1e-15   9%  1s9hA  [c.37.1.20] REP 40 PROTEIN
    1e-15  15%  1t3wA  [a.236.1.1] DNA PRIMASE
    2e-15  12%  1ovmA2 [c.36.1.5] INDOLE-3-PYRUVATE DECARBOXYLASE A:3 -- 180
    2e-15  19%  1vplA  [c.37.1.12] ABC TRANSPORTER, ATP-BINDING PROTEIN
    2e-15  17%  1fl9A  [c.37.1.18] HYPOTHETICAL PROTEIN HI0065
    3e-15  14%  1g6oA  [c.37.1.11] CAG-ALPHA
    4e-15  11%  1n25A  [c.37.1.20] LARGE T ANTIGEN
    4e-15   8%  1bgxT2 [c.120.1.2] TAQ DNA POLYMERASE T:1 -- 173
    4e-15  13%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
    6e-15  12%  3cddA1 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:181 -- 348
    8e-15   7%  2gx8A1 [c.135.1.1] NIF3-RELATED PROTEIN A:4 -- 373
    1e-14  10%  1j1zA2 [d.210.1.1] ARGININOSUCCINATE SYNTHETASE A:171 -- 395
    5e-14   7%  1mi8A  [b.86.1.2] DNAB INTEIN
    6e-14  13%  1ffhA2 [c.37.1.10] FFH A:89 -- 295
    6e-14   9%  2qgmA1 [c.150.1.3] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN A:33 -- 445
    7e-14  10%  1cd5A  [c.124.1.1] PROTEIN (GLUCOSAMINE 6-PHOSPHATE DEAMINASE)
    8e-14  13%  1zs3A1 [a.25.1.1] LACTOCOCCUS LACTIS MG1363 DPSA A:3 -- 173
    9e-14  12%  1udwA  [c.37.1.6] URIDINE-CYTIDINE KINASE 2
    1e-13  12%  1b77A2 [d.131.1.2] PROTEIN (SLIDING CLAMP) A:111 -- 228
    1e-13  11%  1d6jA  [c.37.1.4] ADENOSINE-5'PHOSPHOSULFATE KINASE
    2e-13  12%  1jbkA  [c.37.1.20] CLPB PROTEIN
    4e-13  24%  1w1wA  [c.37.1.12] STRUCTURAL MAINTENANCE OF CHROMOSOME 1
    4e-13  12%  2f9hA1 [b.161.1.1] PTS SYSTEM, IIA COMPONENT A:3 -- 123
    5e-13   8%  1e3mA2 [c.37.1.12] DNA MISMATCH REPAIR PROTEIN MUTS A:567 -- 800
    7e-13  22%  2fggA1 [d.50.5.1] HYPOTHETICAL PROTEIN RV2632C/MT2708 A:4 -- 87
    1e-12  11%  1ak2A1 [c.37.1.1] ADENYLATE KINASE ISOENZYME-2 A:14 -- 146 A:177 --
    2e-12  10%  1dhyA1 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:1 -- 132
    2e-12  11%  1atrA1 [c.55.1.1] HEAT-SHOCK COGNATE 70 KD PROTEIN A:2 -- 188
    2e-12  16%  1np6A  [c.37.1.10] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
    2e-12   8%  3cddA2 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:2 -- 180
    2e-12  17%  1viaA  [c.37.1.2] SHIKIMATE KINASE
    3e-12  16%  1bs2A1 [a.27.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:484 -- 607
    3e-12   3%  1o7d.2 [b.30.5.6] LYSOSOMAL ALPHA-MANNOSIDASE C:488 -- 585 D:603 --
    4e-12   7%  2gtlM1 [b.61.7.1] HEMOGLOBIN LINKER CHAIN L1 M:102 -- 225
    8e-12  15%  2vgmA3 [d.79.3.2] DOM34 A:278 -- 381
    8e-12  25%  1g6hA  [c.37.1.12] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    1e-11  10%  1gm5A1 [a.24.21.1] RECG A:7 -- 105
    2e-11  18%  1l7lA  [b.18.1.16] PA-I GALACTOPHILIC LECTIN
    3e-11  15%  2gujA1 [b.106.1.3] PHAGE-LIKE ELEMENT PBSX PROTEIN XKDM A:5 -- 143
    6e-11  11%  1qhdA1 [a.115.1.2] VIRAL CAPSID VP6 A:1 -- 148 A:333 -- 397
    9e-11  17%  1mm8A  [c.55.3.4] TN5 TRANSPOSASE
    1e-10  14%  2vnuD1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP44 D:400 -- 494
    3e-10  11%  1ckvA  [d.137.1.1] PROTEIN (PROTEIN B)
    3e-10  12%  1g8yA  [c.37.1.11] REGULATORY PROTEIN REPA
    6e-10  19%  1t9hA2 [c.37.1.8] PROBABLE GTPASE ENGC A:68 -- 298
    6e-10  11%  1bccF  [f.27.1.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    7e-10  16%  1vhhA  [d.65.1.2] SONIC HEDGEHOG
    8e-10   4%  1v47A1 [b.122.1.3] ATP SULFURYLASE A:4 -- 135
    1e-09   7%  2pa7A1 [b.82.1.1] DTDP-6-DEOXY-3,4-KETO-HEXULOSE ISOMERASE A:2 --
    1e-09  14%  2ancF1 [c.37.1.1] GUANYLATE KINASE F:3 -- 206
    1e-09  11%  1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306
    2e-09  13%  1ii8.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    2e-09  16%  2je6I3 [d.51.1.1] EXOSOME COMPLEX RNA-BINDING PROTEIN 1 I:153 --
    2e-09  16%  1d8jA  [a.4.5.18] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    3e-09  10%  1yvuA2 [c.55.3.10] HYPOTHETICAL PROTEIN AQ_1447 A:315 -- 706
    7e-09  10%  1jqjA3 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:245 -- 366
    8e-09   9%  1v37A  [c.60.1.1] PHOSPHOGLYCERATE MUTASE
    1e-08  12%  1puoA2 [a.101.1.1] MAJOR ALLERGEN I POLYPEPTIDE, FUSED CHAIN 2, A:5
    1e-08   8%  1yj5A2 [c.37.1.1] 5' POLYNUCLEOTIDE KINASE-3' PHOSPHATASE A:351 --
    1e-08   7%  1afrA  [a.25.1.2] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    3e-08  15%  1g8fA3 [c.37.1.15] SULFATE ADENYLYLTRANSFERASE A:390 -- 511
    4e-08  14%  1odfA  [c.37.1.6] HYPOTHETICAL 33.3 KDA PROTEIN IN ADE3-SER2
    7e-08   9%  1l1oA  [b.40.4.3] REPLICATION PROTEIN A 14 KDA SUBUNIT
    7e-08  12%  1iqrA2 [c.28.1.1] PHOTOLYASE A:2 -- 171
    1e-07  11%  1tmkA  [c.37.1.1] THYMIDYLATE KINASE
    1e-07   6%  1dnpA2 [c.28.1.1] DNA PHOTOLYASE A:1 -- 200
    1e-07  15%  1jqjA2 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:123 -- 244
    1e-07  15%  1f8xA  [c.23.14.1] NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE
    1e-07  14%  1cr0A  [c.37.1.11] DNA PRIMASE/HELICASE
    2e-07  17%  1mkyA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGA A:2 -- 172
    3e-07  14%  1zbsA1 [c.55.1.5] HYPOTHETICAL PROTEIN PG1100 A:108 -- 283
    7e-07  11%  1xl3C1 [a.243.1.1] PROTEIN TYPE A C:2 -- 92
    1e-06  18%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
    2e-06  13%  1iioA  [a.39.4.1] CONSERVED HYPOTHETICAL PROTEIN MTH865
    2e-06  28%  1em8A  [c.128.1.1] DNA POLYMERASE III CHI SUBUNIT
    3e-06  16%  1oa8A  [b.145.1.1] ATAXIN-1
    3e-06  16%  2bsqE1 [a.43.1.8] TRAFFICKING PROTEIN A E:2 -- 70
    4e-06  22%  1j90A  [c.37.1.1] DEOXYRIBONUCLEOSIDE KINASE
    2e-05  17%  1esmA  [c.37.1.6] PANTOTHENATE KINASE
    2e-05  12%  1e2hA  [c.37.1.1] THYMIDINE KINASE
    5e-05   8%  1tueA  [c.37.1.20] REPLICATION PROTEIN E1
    6e-05   8%  1sbxA  [a.6.1.4] SKI ONCOGENE
    2e-04  12%  1q3tA  [c.37.1.1] CYTIDYLATE KINASE
    2e-04   9%  1a4iA2 [c.58.1.2] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:2 --
    2e-04  18%  1ckeA  [c.37.1.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    7e-04  24%  1lnzA2 [c.37.1.8] SPO0B-ASSOCIATED GTP-BINDING PROTEIN A:158 --
    7e-04  10%  1uouA3 [d.41.3.1] THYMIDINE PHOSPHORYLASE A:374 -- 480
:210

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIELKQVSKSFGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYRGKDLANYKSS
1b0uA           KLHVIDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSGAIIVNGQNINLVRDK
1sgwA           KLEIRDLSVGYDKPVL-ERITMTIEKGNVVNFHGPNGIGKTTLLKTITYLKPLKGEIIYNGVPITKV---
1ji0A           VLEVQSLHVYYGAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIGLVRAQKGKIIFNGQDITNKPAH
1q3hA           LEKVSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLIGELEASEGIIKHSGRVSFCSQFS
1l7vC           --QLQDV----AESTRLGPLSGEVRAGEILHLVGPNGAGKSTLLARXAGXTSGKGSIQFAGQPLEAWSAT
1e69A           -------KLYLKGFKSFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENLPPAGS
1mukA           ----------------------------VKWRMCEAREPSVDLLPLCAGIDPLNSDPFLKMVSVGPMLQS
1m3eA1          -------TKFYT---DAVEAVKDIPNGATVLVGGFGLCGIPENLIGALKTGVKELTAVSNNAGVDNFGLG
1pf4A1          -VDVKDVTFTYKEKPALSHVSFSIPQGKTVALVGRSGSGKSTIANLFRFYDVDSGSICLDGHDVRDYKLT
2yyeA2          ------------------------QVGQLLILTKPIGTGILIKGLKEGILKEEDINEAIENMLALNDKAR
1ex6A           ---------------------------RPIVISGPSGTGKSTLLKKLAEYPDSFGFSVSSTTRTPRAGE-
1qhlA           -GKFRSLTLINWN--GFFARTFDLDELVT-TLSGGNGAGKSTTMAAFVTALIPDLTLLLHGKLKAGV---
1e9rA           -GKLKRMTREKAKQVTVAGVPMPRDAERHLLVNGATGTGKSVLLRELYTGLLRGDRMVIVDPNGDMLS--
2gk3A1          ----------------------------------------------------------------------
1khbA1          ----------LAEHMLVLGITNPEGEKKYLAAAFPSACGKTNLAMMNPSLPGWKVECVGDDIAWMKFDAQ
1urjA           -TTGEALCERLGLDPVTEGFKEAVCINNTFLHLG--GSDKVTIGGAEHRIPVYPLQLFMPDFSIAEPFNA
1mjgM           GIKLTKIKLDLPINFGPAFEGESIRKGDMYVEMGGNRTPAFELVRTVSESEITDGKIEVIGPDIDQI--P
1nijA1          --------------------------IAVTLLTGFLGAGKTTLLRHINEQHGYKIAVIENEFGE-VSVDD
1ohcA1          --------------------------------------------------RDPQDDVYLDITDRLCFAIL
1bmfA3          IIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQRFNDGTDEKKKLYCIYVAI
1pv4A3          -ILFENLTPLHANSRLRXDLASPIGRGQRGLIVAPPKAGKTXLLQNIQSIAYNHPDCVLXVLLI-----D
1c4oA1          -FRYRGPSPKGDQPKAIAGLVEALRDGERFTLLGATGTGKTVTMAKVEALGRPALVLAPNKILAAQLAAE
1e6cA           ---------------------------EPIFMVGARGCGMTTVGRELARALGYEFVIFMQHTSGMTVADV
2v3jA1          --------------QAPPVLTSKDKITKRXIVVLAXASLETHKIYVLLNCDDHQGLLKKXGRDISEARPD
1tljA           ------LVWEELREKALNKIYHDKEIGYLDPDIL------GFLLAFYRNRNDVYTQSSCSGRITIVDAEM
2iqhA1          -EEIRRIWRQANNGDDATHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTMVM
1jalA1          --------------------------GFKCGIVGLPNVGKSTLFNALTKAGPFCTIEPNTGVVPMPDPRL
1es6A2          ----------------------------------------------------------------------
1t06A           ------------------QELEALGKERTKKIYISNGAHEPVFGVATGAMKPIAK-KIKLNQELA-EELY
1xbtA1          --------------------------GQIQVILGPMFSGKSTELMRRRRFQIAQYKCLVIKYAKDTRALP
1f46A           -----------------------------------------IIMNVAAHHGELNGELLLNS---------
1kgdA           --------------------------RKTLVLLGAHGVGRRHIKNTLITKPDRFAYPIPHTTRPPEENGK
1zp6A1          -------------------------GGNILLLSGHPGSGKSTIAEALANLPVPKVHFHSDD-----LWGY
1i1qA           VDRYSYVMHLVSVGELRHDLDALHAYRACMNMGTLSGAPKVRAMQLIADAEGQR---------------R
1jjvA           --------------------------TYIVGLTGGIGSGKTTIANLFTDLGVPLVDADVVAREVV--AKD
1jb1A           ------------ERRSXHGVLVDIY-GLGVLITGDSGVGKSETALELVQRGHRLIADDRVDVYQQDEQTI
2axpA1          ------------------------------ILEGPDCCFKSTVAAKLSKELKYPIIKGSAKSGNEKLFEH
1rkbA           ------------------------MLLPNILLTGTPGVGKTTLGKELASKSGLKGDLAREEQLYDGYDEE
1l3aA           --------------------------------------------------KVFVGYSIYKGKAALTVE--
1grqA           -------------------------TTRMIILNGGSSAGKSGIVRCLSVLPEPWLAFGVDSLI-EAMPLK
1f2t.1          ----------------------------------------------------------------------
1poiA           ------------------AIAKYVHSGDHIALGGFTTDRKAAVFEILRQGITLTGLGGAAGGDWDMLIGN
1s9hA           ILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENF---PFN
1t3wA           ---------------------------------------KRTTXRILIGLLVQNATLVPPLENLDENKLP
1ovmA2          VIDSPDICWVGCANEASYAADGYARCKGFAALLTTFGVGELSAMNIAGSYAEHVPVLHIVGAPGTAA---
1vplA           -VVVKDLRKRIGKKEILKGISFEIEEGEIFGLIGPNGAGKTTTLRIISTLIKPSSGIVTVFGKNVVEEPH
1fl9A           -IPDEFSMLRFGKKFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMQGIGHQGNVKSPTYTLVEEYNIA
1g6oA           FEEQGFYNLLDNKEQAISAIKDGIAIGKNVIVCGGTGSGKTTYIKSIEFIPKEERIISIEDTEEIVF---
1n25A           -------------------MVYNIPKKRYWLFKGPIDSGKTTLAAALLELCGGKALNVNLPVAIDQFLVV
1bgxT2          -------------------------------------------MRGMPLFEPKGRVLLVDGH--------
1lw7A2          ------------------------FFAKTVAILGGESSGKSVLVNKLAAVFNTTSAWEYGREFVFEKLGG
3cddA1          ----------------------------------------------------------------------
2gx8A1          ---------------------EVRKALGDAGAGHIGNYSHCTFSSEGTGTFPQQLTIIPASLQR------
1j1zA2          ----------------------------------------------------------------------
1mi8A           RVSIKDLLDEKDFEIWAINEQTMKLESAKVSRVFMTGKKLVYILKTRGRTIKATANHRFLTID-GWKRLD
1ffhA2          ------------------ARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYKGKGRRPLLVAADTQRPAAR
2qgmA1          ----------------------------------------------------------------------
1cd5A           -VSFKHVVTFNMEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLGNAPDIDAECRQYEEKIRSYGKI
1zs3A1          ----------------------------------------------------------------------
1udwA           --------------------------PFLIGVSGGTASGKSSVAKIVQLLQKQVVILSQDSFYRVLTSEQ
1b77A2          -----------------ASVITEIKAEDLQQLLRVS----RGLQIDTIAITNKDGKIVINGYNKVEDSGL
1d6jA           ----------ASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVR-----DRRVHAYRLDGD
1jbkA           -ERAEQGKPVIGRDEEIRRTIQVLQTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLGRRVLALDMG
1w1wA           --------KSYRGVTKVG-----FGESNFTSIIGPNGSGKSNMMDAISFVLGVLKDLIYRGPQSANGDTS
2f9hA1          ----------------------------------------------------------------------
1e3mA2          -IRITEGREQVLNEPFIANPLNLSPQRRXLIITGPNXGGKSTYXRQTALIALAYIGSYVPAQKVEIGPID
2fggA1          ----------------------------------------------------------------------
1ak2A1          --------------------------GVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVASGS
1dhyA1          ----------------------------------------------------------------------
1atrA1          -----------------KGPAVGIDLGTTYSCVGVFQHGKVEIANDQGNRTTPSYVAFTDTERLIGDAAK
1np6A           --------------------------IPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTHHELRK
3cddA2          -LKAGGKITKIGITRSLEAXSGAFDLEXTYKFLGNDAQYKAFIEPIKQGQACTVDIGGERVITGYVDDWV
1viaA           ---------------------------KNIVFIGFXGSGKSTLARALKDLDLVFLDSDFLIEQKFNQKVS
1bs2A1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
2gtlM1          -TITAAHRKSFFPNRATLSYELDEHDHTVSTTQLRGFYNFGKRELLLAPLKGQSEGYGVICDFNLGDDDH
2vgmA3          ----------------------------------------------------------------------
1g6hA           ILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKTLINVITGFLKADEGRVYFENKDITNKEPA
1gm5A1          ----------------------------------------------------------------------
1l7lA           ------------------EVLANNEAGQVTSIIYNPGDVITIAAGWASYGPTQKWGPQGDREHPDQGL--
2gujA1          ----------------------------------YVKKGSDPYFTLQAVLDQSSGRVTLYDVNFDSAKIA
1qhdA1          SGIKFKRINFDNSSEYIENWNLQNRRQRTSVLADASETMLANVTSVRQEYAIPVGPVFPPGMNWTDLITN
1mm8A           ----------------------------------------------------------------------
2vnuD1          RIRTRRAAELLDKRIVISIDSHKYPLGHFVRDLGTIESAQAETEALLLEHD-------------------
1ckvA           -AGIMGLKGKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILTDYKKNVNPTVNVEDRAGYWWI
1g8yA           -HKPINILEAFAAPPPLDYVLPNMVAGTVGALVSPGGAGKSMLALQLAAQIAGGPDLLEVGELPTGPVIY
1t9hA2          ------------------------------------------------------GGLVADTPGFSSLEFT
1bccF           ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2ancF1          --------------------------GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQVLATGIDW
1ni3A1          ------------------VQWGRPGNNLKTGIVGXPNVGKSTFFRAITKSVLGNPPYATIDPEEAKVAVP
1ii8.1          -----------------------------------------------------------------KDFTE
2je6I3          -----------------NGIVIDIMPVKVPRVIGKNKSMYETLTSKSI-FVANNGRIWAFSEEILIEAIR
1d8jA           ----------------------------------------------------------------------
1yvuA2          --------------------------GKSLILAQTREEAKEKLIPVI---NKIKDVDLVIVFEFLLYDFV
1jqjA3          -DLLKQARAAAASNEKFRGVRLYVSENQLKITANNPEQEEAEEILD----------VTYSGAEMEIGFNV
1v37A           ----------------------------------------------------------------------
1puoA2          ----------------------------------------------------------------------
1yj5A2          --------------------------------VGFPGAGKSTFIQEHLVSAGYVHVNRDTLGSWQRCVSS
1afrA           -------------REVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLPVEKCWQPQDFLPDPASDGFDEQ
1g8fA3          ------------------------KQGFSIVLGNSLTVSREQLSIALLSTFLQFGGRYYKIFEHNNKTEL
1odfA           ---VLDYTIEFLDKYIPEWFETGNKCPLFIFFSGPQGSGKSFTSIQIYNMEKYGGEKSIGYASIDDFYLT
1l1oA           -----------LPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILS-DGEGKNGTIELMEP-LDEEI
1iqrA2          ----------------------------------------------------------------------
1tmkA           --------------------------GKLILIEGLDRTGKTTQNILYKKLQPNCKLLKFPERSTRIGGLI
1dnpA2          ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1cr0A           -----SVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGMGKKVGLAMLEESVEETA
1mkyA1          --------------------------ATVL-IVGRPNVGKSTLFNKLVKDPVQDTVEWYGKTFKLVDTCG
1zbsA1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
1yr6A1          ----------------------------IVVFVGTAGSGKTTLTGEFRYLEDNYKVAYVNLDTGVKELPY
1iioA           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
2bsqE1          ----------------------------------------------------------------------
1j90A           --------------------------PFTVLIEGNIGSGKTTYLNHFEKYEPVEKWRNVNGVNLLELMYK
1esmA           LSRLLNFYISSNLRREQFLGTNGQRIPYIISIAGSVAVGKSTTARV------------------------
1e2hA           --------------------------LLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRV---LGAS
1tueA           --------------GALKSFLKGTPKKNCLVFCGPANTGKSYFGMSF--IHFIQGAVISFVNSTSHFWLE
1sbxA           ----------------------------------------------------------------------
1q3tA           --------------------------TIQIAIDGPASSGKSTVAKIIGFTYLDTGAMYKNQLGVEEVEAL
1a4iA2          ----------------------------------------------------------------------
1ckeA           --------------------------APVITIDGPSGAGKGTLCKAMQWHLLDSGAIYHHHVDVASEDAL
1lnzA2          ------------------------------GLVGFPSVGKSTLLSVVSSAKPKIADYHF-----------
1uouA3          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGGES
1b0uA           DGQLKVLTMVFQHFNLWSHMTVLENVMEAPIQLGLSKHDARERALKYLAKVGIDERAQGKYPVHLSGGQQ
1sgwA           ---KGKIFFLPEEIIVPRKISVEDYLKAVASLYGVKVNKNEIMDALES----VEVLDLKKKLGELSQGTI
1ji0A           VINRXGIALVPEGRRIFPELTVYENLXXGAYNRKDKEGIKR-DLEWIFSLFPRLKERLKQLGGTLSGGEQ
1q3hA           WIMPG-----------TIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQD-NTVLGEGGVTLSGGQR
1l7vC           KLALH-RAYLSQQQTPPFATPVWHYLTLHQHDKTRTELLNDVAGALALDD------KLGRSTNQLSGGEW
1e69A           AYVELVFEENGEEITVARELKVNAYQRVNESFNRFISLLFFGGEGRLEISIRKPGR-RDQKLSLLSGGEK
1mukA           --TRKYFAQTLFMAKTVSGLDVNAIDSALLRLRTLGADKKALTAQL--LMVGLQESEADALAGKIMLQDV
1m3eA1          LLLQSKQSSYVGENAEFERQYLAGELEVELTPQGTLAERIRAGGAGVPAFYTSTGYGVQEGGSPIKYNKD
1pf4A1          NLRRHVSQNVHLFNDTIANNIAYAEGEYTREQIEQAARQAHAMEFIENMPQGLDT-VIGENGTSLSGGQR
2yyeA2          NLMLSLDATACTDVTHAWNICKNSNIGARIFFEKVPYYQENLVKKKIYPKGAIENL-NFVKNYLKSNLDN
1ex6A           ---VNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQVSKSGKTCIL-DIDMQGVKSVKAI
1qhlA           --CYSMLDTINSRAGRDRKVDIKPFAIQGLPMSVQPTQLVTETLNERQARVLPLNELKDKQFNSITDYHS
1e9rA           -KFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGR-LLLRETAKKLAL
2gk3A1          ------LKVLFIGESWHIHXIHSKGYDSF---TSSKYEEGATWLLECLRKGGVDIDYQIAFPESIDELNR
1khbA1          GHLRAINPENGFFGVAPGTSVKTNPNKTIQKNTIFTNVAETSDGGVYWEGIDEPLA-SGVTITSWKNKEW
1urjA           NHRSIGEKFTYPLPFFNRFEAVVGPAAVALRSRNVARAAAHLAFDENHEGAA-LPADITFTAFAGGFEQR
1mjgM           EGSKLPLGILVDIYGRKMQADFEGVLE---RRIHDFINYGEGLWHTGQRNINWLRVSKDAVAKGFRFKNY
1nijA1          QLIGDRATQIKTLTNGCICCSRSNELEDAL----LDLLDNLDKGNIQFDRLVI-ECTGMADPGPIIQTFF
1ohcA1          YSRKSASNVHYFSIDELEYENFYADF--GPLNLAMVY-RYCCKINKKLKSITML---RKKIVHFTGSDQR
1bmfA3          GQKRSTVAQLVKRLAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHAL-IIYDDLSKQAVAYR
1pv4A3          ERPEEVTEXQRLVKGEVVASTFDEPASRHVQVAEXVIEKAKRLVEHKKDVIIL-------LDSITRLARA
1c4oA1          FRELFPENAVEYFISYQPEAYVPGKDLYIEKDASINPEIERLRHSTTRSLL----TRRDVIVVASVSAIY
1e6cA           VAAEGWPGFRRRESEALQAVATPNRVVATGGGMVLLEQNRQFMRAHGTVVYLFAPAEELAAHQRPTLTGR
2v3jA1          ITHQCLLTLLDSPINKAGKLQVYIQTSRGILIEVNPTVRIPRTFKRFSGLXVQLL-HKLSIRSEEKLLKV
1tljA           PKNSTIIFKNHLRITEQDLEDVLSKNQVRRLWLIVQGPIIHIYAKNIETGWDILKIAREAGFKGILATNQ
2iqhA1          ELIRM-IKRGINRRTRIAYERMCNILKGKFQTAAQRTMVDQVRESRNPGNAEFEDLILARSALILRGSVA
1jalA1          DALAEIVKPERILPTTM-EFVDIAGLVAGASKGEGLGNKFLANIRETDAIGHVVRCFENIDPLDDIDTIN
1es6A2          -------GALRPGISFHPK--LRPILLPNKNSADLTSPEKIQAIMTSLQDFKI---VPIDPTKNIMGIEV
1t06A           ATGNYDAMYFAGIIADPKAMSESDFDRW------IDGAYFYMLSDYVVAVTLSESNIAQDVADKWIASGD
1xbtA1          ACLLRDVAQEALGVAVIGIDEGQFF---------PDIVEFCEAMANAGKTVIVAA-LDGTFQRKPFGAIL
1f46A           ---IQQAGFIFGDMNIYHRHLSPDGSGPAFSLANMVKPGTFDPEMKDFTTPGVTIFMQVPSYGDELQLFK
1kgdA           NYYFVSHDQMMQDISNNEYLEYG-----------SHEDAMYGTKLETIRKIHEQGLIAILDVPQALKVLR
1zp6A1          IKHGRIDPWLPQSHQQNRXIXQIAADVAGRYAKEGYFVILDGVVRPDWLPAFTALARPLHYIVLRTTAER
1i1qA           GSYGGAVGYFTAHGDLDTCIVIRSALVENGIATVQAGAGIVLDSVPQSEADETR---------NKARAVL
1jjvA           SPLLSKIVEHFGAQILNRAALRERV-------------FNHDEDKLWLNNLLHPA-IRERMKQKLAEQTA
1jb1A           VGAAPPILSHLLEIR---GLGIIDVXNLFGAGAVREDTTISLIVHLENWTPDQLIFDVPKITVPVKVGRN
2axpA1          FNKLADEDNVIIDRFVYSNLVYAKKFKDYSILTERQLRFIEDKIKAKAKVVYLHPSVIKKRLYIEGKDID
1rkbA           YDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERL-ETRGYNEKKLTDN
1l3aA           PRSPEFSPLDSGAFKLSREGMVMLQFAPAAGVRQYDWSRKQVFSLSVGSIISLGTKDSCEFFHDPNKGRS
1grqA           MQSAEGGIEFDADGGVSIGPEFRALEGA--------WAEGVVAMARAGARIIIDDVFLGGAAAQERWRSF
1f2t.1          -------------------------------------SEVVVRAEENKVRLFVVWEGKERPLTFLSGGEA
1poiA           GRVKAINCYTANSGVTNVSRRFRKWFEAGKLTYSQDVIYMMWHAAALGLPFLPVTLMQGSGLTDSKEVRK
1s9hA           DCVDKMVIWWEEGKMTAKVVESAKAILGGSK-----VRVDQKCKSSAQIDPTPVIVTSNTNMCAVIDGNS
1t3wA           GLGLF--RELVNTCLSQPGLTTGQLLEHY-------RGTNNAATLEKLSXWDD---IADKNIAEQTFTDS
1ovmA2          QQRGELLHHTLGDGEFRHFYHMSEPITVAQAVLTEQNACYEIDRVTMLRERRPGYLMLPADV--------
1vplA           EVRKL--ISYLPEEAGAYRNMQGIEYLRFVAGFYASSSSEIEEMVERATEIAGLGEKIKDRVSTYSKGMV
1fl9A           GKIYHFDLYRLADPEELEFMGIRDY----FNTDSICLIEWSEKGQGILPEADIIDYYDDARNIELIAQTN
1g6oA           -KHHKNYTQLFFGGNITSADCLKSCLRXRPDRIILGELRSSEAYDFYNVLCSGHKGTLTTLHAGSSEEAF
1n25A           FEDVKGTGGESRDLPSGQGINNLDNLDYLDGSVKVNLEKKHLNKRTQIFPPGIVTMNEYSVPKTLQARFV
1bgxT2          -------HLAYRTFHALKGLTTSRGEPVQAVYLLKALKEDGDAVIVVFDAKAPSF-RHEAYGGYKAGRAP
1lw7A2          DEQAMQYSDYPQXA-----------------LGHQRYIDYAVRHSHKIAFIDTDFI-TTQAFCIQYEGKA
3cddA1          -------------------------------ASKTKAGVSLILGDNVKAARGRFSW-RQRFSKFTIKAAK
2gx8A1          KVIKAMVTAHPYEEVAYDVYPLDNKG---ETLGLGKIGYLQEEMTLGQFAEHV-KQSLDVKGARVVGKLD
1j1zA2          --YSMDANLLHISYEGGVLEDPWAEPPKGM----FRMTQDPEEAPDAPEYVEVE--FFEGDPVAVNGERL
1mi8A           ELSLKEHIALPRKSDISWDSIVSITETGVEEVFDLTVPGPHNFVANDI----------------------
1ffhA2          EGEKVGVPVLEVMDGESPESIRRRVEEKARLEAR------------------------DLILVDTAGRLQ
2qgmA1          -------------------------------------SGQS-VQKNIVKSIQS---QANPLKTIEPSKPF
1cd5A           HLFMGGVGNDGHIAFNEPASSLASRTRIKTLTHDTRVANSRFFDNDVNQVPKYALTVGVGTLLAVEGCVN
1zs3A1          -------AEIDHHKPTAGAGHVLSNLFIENLTQAGIYAKSPVKCEYLREIAQRE-VEYFFKISDLLLDEN
1udwA           KAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSR-----------KEETVTVYPADV
1b77A2          TRPKYSLTLTDYDGNNFNFVINMANMKIQPGNYKVMLWGAGDKVAAKFESSQVSYVIAMEADSTHD----
1d6jA           NIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYR-----KDRDTARQLHEVATPGEE
1jbkA           ALVAKYRGEFEERLKGVLNDLAKQEGNVILFIDELHTMVGAMDAGNMLKPALARG-ELHCVGATTLDEYR
1w1wA           YKIDGKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPVELSRMFTFDYVSDHKDMEYLSGGEK
2f9hA1          --IGKHAIDDSEKXIILFGETATDTLKQHAVIQSFPEKDQVTLAEGDHLKIGDTNY-TITKVGSFANSNL
1e3mA2          RIFTRV-GFXVEXTETANILHNATEYSLVLXDEIGRGTSTYDGLSLAWACAENLANKIKALTLFATHYFE
2fggA1          -------------------------------------SEHVGKTCQIDVLIEEHDE-RTRAKARLSWAGR
1ak2A1          ELGKKLKATMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKKLDSVIEFSIP
1dhyA1          ---------------------------------------ERLGYLAVKDVPAWDHF-LTKSVGLMAAGSA
1atrA1          NQVAMNPAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSMKEIAEAYLGKTVTNAV-VTVPAYFNDSQR
1np6A           AGAAQTIVASQQRWALMTETPDEEELDLQFLASRMDT-----------------SKLDLILVEGFKHEEI
3cddA2          PSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFVIVNTDVGEPFQRIQIEQGET
1viaA           EIQKRENFFREQEQKXADFFSSCEKACIATGGGFVNVSNLEKAGFCIYLKADFEYLKKKRPLFYDEIKAK
1bs2A1          ---------------------------------------------------------LQYAHSRLRSVER
1o7d.2          ----------------------------------------------------------------YNPLGR
2gtlM1          AIVVPSSLFVCAHFNAQR----------------------------------------------------
2vgmA3          ------------------------------------------KEIMVMDEF---LLHLNKDDDKAWYGE-
1g6hA           ELYHYGIVRTFQTPQPLKEMTVLENLLIGSLFYKKWIPKEEEMVEKAFKILEFLKLSYDRKAGELSGGQM
1gm5A1          -------------SSLFLWGEALPTLLEEFLNEVEKMLKNQVNTRRIHQLLKE-LDDPLLENKDLEEKLQ
1l7lA           ICHDAFCGALVMKIGN----SGTIPVNTGLFRWVAPNNVQGAIT--------LIYNDVPGTYGNNSGSFS
2gujA1          SLDEEEVPFTFEDFDVPEK---------------------------------------------------
1qhdA1          ---YSPSREDNLQR-VFTVASIRSML--------------------------------------------
1mm8A           ---------VFSSAALGDPRLVNVAAQLAKYSITISSEGSKAAQEGAYRFIRNPNVSAEA---IRKAGAM
2vnuD1          ----------------------------------------------------------------------
1ckvA           KAISELLGRQFNVYDFLVDVSSTIG--------RAYTLGNKFTITSELMGLDRKLEDY------------
1g8yA           LPAEDPPTAIHHRLHALGAHLSAEE--------------RQAVADGLLIQPLIGS-LPNIMAPEWFDGLK
1t9hA2          DIEEEELGYTFPDIREKSSSCKFRGCLHLK--------EPKCAVKQAVEDGELKQY-RYDHYVEFMTEIK
1bccF           ---WYYNAAGFNKYGLMRDDTIYENDDVKEAIRRLPENLYDDRMFRIKRALDLN----MRQQILPKEQWT
1vhhA           ---------------------------------KLTPLAYKQFIPNVAEKLGA---SGRYEGKITRNSER
1v47A1          ----------------------------------------------------------------------
2pa7A1          ---------------------------------------KRVYYIFDTKGEEPRGFHAHKKLEQVLVCLN
2ancF1          QGAQQIRQKMPHARSIFILPPSKIELDRLRGRGQDSEEVIAKRMAQAVAEMSHYDYLIVNDDFDTALTDL
1ni3A1          DERFDWLCEAYKPKSRVPAFLTVFDI-AGLTKGASTGVGLGNAFLSHVRAVDAIYQVVRAFDAEIIHVEG
1ii8.1          ELIEKVKKYKALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERGGERIALGLA
2je6I3          KIENE-----------------------------------------------------------------
1d8jA           ----------------------------GSSGYKFGVLA---KIVNYMKTRHQRGDTHLDETQHLDIGLK
1yvuA2          KRELLKKXILNRTLKNENLKFVLLNVAEQVLAKTGNIPYKLKEIEGKVDAF------VGIDISRITRDGK
1jqjA3          SYVLDVLNALKCENVRM-MLTDSVSSVQI-------EDAASQSAAYVVMPMRL-----------------
1v37A           ----------------------------------------------------------YPELREIHFGAL
1puoA2          ---VANGNELLLDLSLTKVNTEPERTAMKKIQDCYVENGLISRVLDGLVMTTIS----------------
1yj5A2          CQAALRQGKRVVIDNTNPDVPSRARYIQCAKDAGVPCRCFNFCATIEQARHNNRFREXTDPSHAPVSDXV
1afrA           VRELR-----------------------------------------------------------------
1g8fA3          LSSGSGLIIPDQWEDDKDSVVGKQNVDIQLESADEPISHIVQKVVLFLEDNGFF----------------
1odfA           HEDQLKLNEQFKNNKLLQGRGLPGTHDMKLLQEVL----NTIFNQDTVV--------LPKYDKSQFKGEG
1l1oA           SGIVEVVGRVTAKATILCT-SYVQFK-EDSHPFDLGLYNEAVKIIHDFPQ--------------------
1iqrA2          --------------------------------RGDLRLHDHPALLEALARGPVVGL-VVLDPNNLKTTPR
1tmkA           NEYLT-----DDSFQLSDQAIHLLFSANRWEIVDKIKKDLLEGKNIVMDRYVYSG-VAYSAAKGTNGMDL
1dnpA2          -----------THVWFRQDLRLHDNLALA-----------AACRNSSARVLALYIA-TPRQWATHNMSPR
1jqjA2          ----------------------QSEVEFTLPQATMKRLIEATQFSMAHQDVGM-LFETEGEELRTVATDG
1f8xA           -----------------------------------------------------------KTIYFFTDRQN
1cr0A           EDLIGLHNRVRLRQSDSLKREIIENGKF----------------DQWFDE--LFGNDTFHLYDSFAEAET
1mkyA1          VFDNPQDIISQKXKEVTLNXIREADLVLFVVDGKRGITKEDESLADFLRKSTVDTI-LVANKAENLREFE
1zbsA1          ----------------------SEGIACILGTGSNSCLFDGREIKANV--SPLGYIL-GDEGSGAVLGRL
1xl3C1          ----------------------------------ANAFSLPTPEIXVRFYQDLXRM-FRLFPLGVFSDEE
1yr6A1          EPSIDVREFVTVEEIMREG---------------------------------------------------
1iioA           -----------------------SHMKMGVKEDIRGQIIGALAGADPEELMAALPNGPDTTCKSLKASDA
1em8A           ----------------------------------------------------------------------
1oa8A           -----------------------EDLKTEDFIQSAEISNDLKIDSSTVERIEDSH-SPGVAVIQFAVGEH
2bsqE1          -------------------EATHNAIKFRARAGRSTEAEIRLILDNIAKAQQTVRLGSASIGQEIGGVEL
1j90A           D--PKKWAMPFQSYVTLTMQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEE------
1esmA           ----------------------------------------------------------------------
1e2hA           ETIANIYTTQHRLDQGEISAGDAAVV--------------------------------------------
1tueA           PLTDTKVA-MLDDATTTCWTYFDTYMRNALDGNPIS----------------------------------
1sbxA           ---------------------------------------------------------------DRSTERC
1q3tA           LALLDQHPISFGRSETGDQLVFVGDVDITHPIRE-NEVTNHVSAIAAIPEVREKLVSLQQEIAQQGGIVM
1a4iA2          ----------------------------------------------------------------------
1ckeA           VPLASHLDVRFVS----TNGNLEVILEGEDVSGEIRTQEVANAASQAFPRVREALLRRQRAFRELPGLIA
1lnzA2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           QRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLSLRDDNRLIIIATHNPAIWEMADEVFTMDHLK
1b0uA           QRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGARHVSSHVIFLHQ--
1sgwA           RRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKEKGIVIISREEL---SYCDVNENLHK--
1ji0A           QXLAIGRALXSRPKLLXXDEPSLGLAPILVSEVFEVIQKINQEGTTILLVEQNAGALKVAHYGYVLET--
1q3hA           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQ--
1l7vC           QRVRLAAVVLQITPLLLLDEPXNSLDVAQQSALDKILSALCQQGLAIVXSSHDLNTLRHAHRAWLLKG--
1e69A           ALVGLALLFAKPSPFYVLDEVDSPLDDYNAERFKRLLKENSKHTQFIVI-THNKIVMEAADLLHGV----
1mukA           NTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLLPKDGRHLTDIPPRMGWLRA------------------
1m3eA1          GSIAIASKPREVREFNGQHFILEEAIRGDFALVKAWKA-DQAGNVTFRKSARNFNPXCKAAETTVVE---
1pf4A1          QRVAIARALLRDAPVLILDEATSALDTESERAIQAALDELQKNKTVLVI-AHRLSTIEQADEILVVDE--
2yyeA2          WKLILLSDPVTSGGLLFTINKEKLEK------IDETAKELEVNYWIIGETIAENVL--------------
1ex6A           PELNARFLFIAPPSVEDLKKRLEGRGTETEESINKRLSAAQAEAHDKVIVNDDLDAYKELKDFIFAE---
1qhlA           LMFDLGIIASDRSKFYRLIEASGGISSAITRSLRDYLL--------------------------------
1e9rA           IGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKATSARFVLSDKLPEHVTMPDGDFSIR--
2gk3A1          YDVIVISDIGSNTFLLQNETFYQLKIK---PNALESIKEYVKNGLLXIGGYLSFXGIEAKANYKNTVL--
1khbA1          SSEDGEPCAHPNSRFCTPASQCPIIDAAWESPEGVPIEGIIFGGRRPAGVPLVYEA-LSWQHGVFVGAAM
1urjA           LASVMAGDAALVSMAVFDEPPTDISAWPLFEGRANAVGAYLARAAGLVGAMVFSTNSALHLTEVDD----
1mjgM           GEILVAKMKEEFPAIVDRVQVTIFTDEAKVKEYMEVAREKYKERDDRMRGLTDETVDTFYSCVLCQ----
1nijA1          SHEVLCQRYLLDGVIALVDAVHADEQMNQFTIAQSQ---VGYADRILLTKTDVAGAEKLHERLARINA--
1ohcA1          KQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSYIPFGSCNFYITLLDCFHA-----------------
1bmfA3          QMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAGDVSAYIPTNVISITD--
1pv4A3          YNTVVPAVLTGGVDANALHRPKRFFGAARNVEEGGSLT----IIATALIDTGSKXDEVIYEEFKGTGN--
1c4oA1          GLGDPREYRARNLVGFVLFPATHYLSPEGLEEILKEIEKELWERVRYFEERGEVLYAQRLKERTLYDL--
1e6cA           PIAEEMEAVLREREALYQDVAHYVVDATQPAIVCELMQTMR-----------------------------
2v3jA1          IKNPITDHLPTKCRKVTLSFDAPVIRVQD---YIEKLDDDESICVFVGAXGKDNFADEYVDEKVGLSNYP
1tljA           KGVLVELRTGIRMVHLLRESNTERVDKDKIKTLVNVCNEVLARGKQKMNLLKD-----------------
2iqhA1          HKSCLPACVYGSAVASGYDFEREGYSLVGIDPFR------LLQNSQVYSLIRPNEPAHKSQLVWMACH--
1jalA1          TELALADLDSCERAIQRLQKRAKGGDKEAKFELSVMEKIVLENAGMIRSVGLDKEELQAIKSYNFLTLKP
1es6A2          PETLVLKLTGGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPAS---------------------
1t06A           ELSCYCWLLGNRKDNAFSESKISDMLEMKDTIHHSPERTKSAMNNFLNTVAISYKAVEIAKEVGIVEV--
1xbtA1          NLVPLAESVVKL----------------------------------------------------------
1f46A           LMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDIIREVKD----------------------------
1kgdA           TAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDILQRTYAHYFDLTII-NNEIDTIRHLEEA-------
1zp6A1          CLDRGGDSLSDPLVVADLHSQFADLGAFEHHVLPVSGKDTDQALQSAINALQ--------SGRFRID---
1i1qA           RAIATA----------------------------------------------------------------
1jjvA           PYTLFVVPLLIENKLTALCDRILVVDVSPQTQLARSANFEQIQRIMNSQ-VSQQERLKWADDVINNDA--
1jb1A           LAIIIEVAAXNFRAKSXGYDATKTFEKNLNHLIE------------------------------------
2axpA1          SILELYREVXSNAGLHTYSWDTGQWSSDEIKDIIFLV---------------------------------
1rkbA           IQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIE-QWIKDHN-----------------
1l3aA           DEGRVRKVLKVEPL---PDGSGHFFNLSVQNKLINLDENIYIPEFAVLVSAFNFVM--------------
1grqA           VGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGEYDVEVDTTHKESIECAWAI-------
1f2t.1          FRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAADHVIRI----
1poiA           TLDKVPDDKFKYIDPFKPGEKVVAVPVPQVDVAIIHAQQASPDGTVRIWGGKF-----------------
1s9hA           TTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFY-----------------
1t3wA           LNHXFDSLLELRQEELIARERTHGLSNEERLELWTLNQELA-----------------------------
1ovmA2          ----------------------------------------------------------------------
1vplA           RKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLTILVSSHNLEVEFLCDRIALIHN--
1fl9A           LGKNIIS---------------------------------------------------------------
1g6oA           IRLASSNSAARNIKFESIEGFKDLID-XIVHINHHKQCDEFY----------------------------
1n25A           KQIDFRPKDYLKHCLERSEFLLEKRIIQSGALLLMLIWYRPVAEFAQSIQSRIVEWKERLDKEFSLSVY-
1bgxT2          TPEDFPRQLALIKEVDLLGLARLEVPGYEADDVLASLAKKEKEGYEVRILTADKDYQLLSDRIHVLHP--
1lw7A2          HPFLDSXIKEYPFDVTILLKNN--TEQKQRQQFQQLLKKLLDKYKVPYIEIESPSYLDRYNQV-------
3cddA1          ADVTDSEIGRYRPLIIVNEEVTAEGAAKRGQWERQRSIGKSNXAEYTWRIPQTGKLWNINTLVPVIDE--
2gx8A1          DKVRKVAVLGGDGNKYINQAKFKGADVYVTGDMYYHVAHDMMLGLNIVDPGHNVMKQGVQKQLQEKVD--
1j1zA2          SPAALL----QRLNEIGGRHGVGRVDIVENRFVGMKSRGVYETPGILYHARRAVESLTLDREVLHQRD--
1mi8A           ----------------------------------------------------------------------
1ffhA2          IDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKGVTGLVLTKLDARGGAALSARHVTGKP
2qgmA1          EDLKPLKKXIGNAQYVGLGENTHGSSEIFTXKFRLVKYLVTEXGFTNFAXEEDGNGLKLNEYIQTGKG--
1cd5A           HMWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIKG--------------------------
1zs3A1          EIVPSTTEEFLKYHKFITEDPKAKYWTD-EDLLESFIVDFQAQNMFIIKLANKEEKFALAAGVVEL----
1udwA           VLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYTFVKPAFEEFCLPTKK
1b77A2          ----------------------------------------------------------------------
1d6jA           TGLPFVEVYVDVPVEAPYEAPANKNYELPVQDAVKQIIDYLDTKGYLP----------------------
1jbkA           QYIEKDAALERRFQKVFVAEPSVEDTIAILR---------------------------------------
1w1wA           TVAALALLFYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSD---------
2f9hA1          QSIAHSTLIFA-------DAPTDEDDVIRNGVYLTPHQLPITIGTTIDY---------------------
1e3mA2          LTQLPEK-----XEGVANVHLDALEHGDTIAFXHSVQDGAASKSYGLAVA--------------------
2fggA1          QXVGVGLARLDPA-----DEPVAQIGDEL-----AIARALSDLANQLFALTSSD----------------
1ak2A1          DSLLIRRITGRLIHSDDNKKALKIRLEAYHTQTTPLVEYYSKRGISAIDASQTPDVFASILAA-------
1dhyA1          GDAALYRADQRAWRIAVQPGELDDLAYAGLEVDDAAARMADKLRQAGVAFTRGDEALMQQRKVMGLL---
1atrA1          QATKDAGTIAGLNVLRIINEPTAAAIAYG-----------------------------------------
1np6A           AKIVLFRDGAGHRPEELVIDRHVIAVADVPLNLDVALLDINDVEGLDFVVEWM-----------------
3cddA2          PHELLA-RLAKQRGVLLTSDTFGNLVIT------------------------------------------
1viaA           KLYNERLSKYEQKANFILNIENKNIDELLSE-IKKVI---------------------------------
1bs2A1          NASGITQEKWINADFSLLKEPAAKLLIRLLGQYPDVLRNAIKTHEPTTVVTYL--FKLTHQVSSCYDVLW
1o7d.2          KVDWMVRLPVSKHVYLVKDPGGKIVPSDVVTIPSSDSQELLFSALVPAV-GFSIYSVSQMPRDLVIQN--
2gtlM1          ----------------------------------------------------------------------
2vgmA3          KEVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSVESNGGKALVLSTLHSGEELDQ---------
1g6hA           KLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGIFLIIEHRLDIVLNYIDHLYVMFN--
1gm5A1          AFLDYV------KEIPNLPEARKRYRIQKSLEMIEKLRSW------------------------------
1l7lA           VNIGKD----------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1mm8A           QTVKLAQE----FPELLAIEDTTSL-SYRHQVAEELGKLGSIQDKSRGWWVHSVLLEATTFRTVGLLH--
2vnuD1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1g8yA           RAAEGRRLMVLDTLRRFHIEEENASGPMAQV-IGRMEAIAADTGCSIVFLHHAVDNIRWQSYLSSMTS--
1t9hA2          DR--------------------------------------------------------------------
1bccF           KYEEDVPYLEPYLKEVI-----------------------------------------------------
1vhhA           FK---ELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALNQWPGVKLRVTEGWDEDGHHSEESLHYE--
1v47A1          PALEIGEDERLDLENLA-TGAFFPVKGFMTREEALSVARLPTGEVWTIPILLQFPRVGPGNTVALLHG--
2pa7A1          GSCRVILDDGNIIQEITLDSPAVGLYV--GPAVWHEMHDFSSDCVMMVLASDYYDTDYIRQYDNFKKY--
2ancF1          KTIIRAERLRMSRQKQRHDALISKLL--------------------------------------------
1ni3A1          DVDPIRDLSIIVDELLIKDA--------------------------------------------------
1ii8.1          FRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAADHVIRISL--
2je6I3          ----------------------------------------------------------------------
1d8jA           QKQWLMTALVNNPKIEVIDGKYAFKPKYNVR---------------------------------------
1yvuA2          TVNAVAFTKIFNSKGELVRYYLTSYPAFGEKLTEKAI-------GDVFSL-LEKLGFKKGSKIVVHRD--
1jqjA3          ----------------------------------------------------------------------
1v37A           EGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRLEGLKAPAVLFTHGGVVRAVLRALGEDGLV-
1puoA2          ----------------------------------------------------------------------
1yj5A2          YRKQFEPPTLAEGFLEILEIPFRLQEHL-DPALQRLYRQFSE----------------------------
1afrA           ------------NTARQAKEHGDIKLAQICGTIAA-----DEKRHETAYTKIVEKLFEIDPDGTVLAF--
1g8fA3          ----------------------------------------------------------------------
1odfA           DRCPTGQKIKLPVDIFILEGWFLGFNPILQGIENDLLTGDMVDVNAKL----------------------
1l1oA           ----------------------------------------------------------------------
1iqrA2          RRAWF------LENVRALREAYRARGGALWVLEEKVPEAARRLKAKAVYALTSHTYGRYRDGRVRE----
1tmkA           DWCLQPDVGLLKPDLTLFLST-------QFGDERYETVKFQEKVKQTFMKLLDKEIRKGDESITIVDV--
1dnpA2          QAINAQLNGLQIALAEKGIPLLFREVDDFVASVEIVKQVCAENSVTHLFYNYQYENERARDVEVERAL--
1jqjA2          HRLAVCSMPIGQS----LPSHSVIVPRKGVIELMRMLDGG--DNPLRVQIGSNNIRAHVGDFIFTS----
1f8xA           KAYKEAMEALKENPTIDLENSYVPLDNQYKGRVDEHPEYLHDKVWATATYNNDLNGIKTNDIMLGVYI--
1cr0A           DRLLAKLAYMRSCDVIILDHIS--IRKMIDNLMTKLKGFAKSTGVVLVVICHLKALRQLSDTIIALER--
1mkyA1          REVKPELYSLGFGEPI------------------------------------------------------
1zbsA1          FIGSLLKGQXPEG---LCEAFLQEYGLTSADIIESVYR-KPFPNRFLAGFSPFIAQHLDIPAVYSLVQ--
1xl3C1          QRQNLLQMCQNAIDMAIESE--------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1iioA           GQVLTADFPFKSAEEVADTIVNK-----------------------------------------------
1em8A           ----------KNATFYLLDNDTTVDGLSAEQLVCEIAAERWRSGKRVLIACEDEKLWARPAESF------
1oa8A           RAQVSVEV-LVEYPFFVFGQGWSSCCPERTSQLFDLPCSKLSVGDVCISLTL------------------
2bsqE1          EDVR------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1sbxA           ETETISCFVVGGEKRLCLPQILNSVLRDFSL--QQINAVCDELHIYCSRCTADQLILKVXGILPFSAP--
1q3tA           DGRDIGTVVLPQAELKIFL--VASVDERAERRYKENIAKGIETDLETLKKE-------------------
1a4iA2          ------------PAEILNGKEI---SAQIRARLKNQVTQLKEPGFTPRLAILQVGNRDDSNLYINVKL--
1ckeA           DGRDMGTVVFPDAPVKI--FLDASSEERAHRRMLQLQVKGFSVN-FERLLAEIKLVPAADALVLDSTTL-
1lnzA2          ----------------------------------------------------------------------
1uouA3          --------------------------REQEELLAPADGTVLVRALPLALVLHEGALRLGVGAELLVDV--