[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF56413.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1kskA4.bssp"
#ERROR : Can't open dsspfile "1przA.bssp"
#ERROR : Can't open dsspfile "1v9kA.bssp"
#ERROR : Can't open dsspfile "2apoA2.bssp"
#ERROR : Can't open dsspfile "1k8wA5.bssp"
#ERROR : Can't open dsspfile "1ze2B2.bssp"
#ERROR : Can't open dsspfile "1r3eA2.bssp"
#ERROR : Can't open dsspfile "1vioA2.bssp"
#ERROR : Can't open dsspfile "1dm9A.bssp"
#ERROR : Can't open dsspfile "1kskA3.bssp"
#ERROR : Can't open dsspfile "1jh3A.bssp"
#ERROR : Can't open dsspfile "1h3eA2.bssp"
#ERROR : Can't open dsspfile "1p9kA.bssp"
#ERROR : Can't open dsspfile "1fjgD.bssp"

## Summary of PDB Search
:240
    1e-39  41%  1kskA4 [d.265.1.3] RIBOSOMAL SMALL SUBUNIT PSEUDOURIDINE SYNTHASE A
    7e-34  20%  1przA  [d.265.1.3] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D
    1e-25  23%  1v9kA  [d.265.1.3] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE C
    2e-25  13%  2apoA2 [d.265.1.2] PROBABLE TRNA PSEUDOURIDINE SYNTHASE B A:17 --
    4e-22  15%  1k8wA5 [d.265.1.2] TRNA PSEUDOURIDINE SYNTHASE B A:9 -- 250
    2e-21  17%  1ze2B2 [d.265.1.2] TRNA PSEUDOURIDINE SYNTHASE B B:1 -- 228
    7e-18  20%  1r3eA2 [d.265.1.2] TRNA PSEUDOURIDINE SYNTHASE B A:10 -- 237
    2e-13  32%  1vioA2 [d.66.1.5] RIBOSOMAL SMALL SUBUNIT PSEUDOURIDINE SYNTHASE
    2e-12  18%  1dm9A  [d.66.1.3] HYPOTHETICAL 15.5 KD PROTEIN IN MRCA-PCKA
    3e-11  29%  1kskA3 [d.66.1.5] RIBOSOMAL SMALL SUBUNIT PSEUDOURIDINE SYNTHASE
    7e-11  18%  1jh3A  [d.66.1.4] TYROSYL-TRNA SYNTHETASE
    6e-07  11%  1h3eA2 [d.66.1.4] TYROSYL-TRNA SYNTHETASE A:352 -- 432
    1e-06  21%  1p9kA  [d.66.1.6] ORF, HYPOTHETICAL PROTEIN
    7e-05  25%  1fjgD  [d.66.1.2] 30S RIBOSOMAL PROTEIN S4
:240

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRLDKFLVACAVGSRTEVKNLLKAGRVTVNGKKEKSAKLQIDEKIDEIRFDGQVLEYEEFVYYMMNKPKG
1kskA4          ------------------------------------------------------------RYFXLNKPQG
1przA           ----------------------------------------------RFEPQDIPLDYEDEDIIVINKPRD
1v9kA           -----------------------------------------------------VIXYEDDHILVLNKPSG
2apoA2          ---------------------------------------ETNWDYGCNPYERKIEDLIKYGVVVVDKPRG
1k8wA5          ---------------------------------------------------------DINGVLLLDKPQG
1ze2B2          -------------------------------------------------------------ILVAYKPKG
1r3eA2          -------------------------------------------------------------ILVAYKPKG
1vioA2          LRLDKFIAENVGLTRSQATKAIRQSAVKINGEIVKSGSVQISQE-DEIYFEDELLTW-------------
1dm9A           VRLDKWLWAARFYTRALAREMIEGGKVHYNGQRSKPSKIVELNATLTLRQGNDERTVIVKAITEQRRPAS
1kskA3          -RLDKFIAQQLGVSRAIAGREIRGNRVTVDGEIVRNAAFKLLPE-HDVAYDGNPLAQQ------------
1jh3A           VPLVELLVAGISPSKRQAREDIQNGAIYVNGERLQDVGAILTAE-HRLEGRFTVIRRGKKKYYLIRY---
1h3eA2          IWVARLFTLAGLTSNAEARRLIQNRGLRLDGEVLTDPMLQVDLS-RPRILQRGKDRFVRVRL--------
1p9kA           VELCDLLKEGWSESGAQAKIAIAEGQVKVDGAVETRKRCKIVAG-QTVSFAGHSVQV-------------
1fjgD           SRLDNVVYLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPG-DEIAVAEK-SRNLELIRQNLEAMKG


                         .         .         *         .         .         .         .:140
query           VISATEDPKHRTVLDLLDDLARSKEVFPVGRLDIDTHGLLLLTNNGQLAHVLLSPKRHVDKTYQAQVKGI
1kskA4          YVCSTDDPDHPTVLYFLDEP-VAWKLHAAGRLDIDTTGLVLXTDDGQWSHRITSPRHHCEKTYLVTLESP
1przA           LVVPGAGNPDGTVLNALLHIADVPRAGIVHRLDKDTTGLXVVAKTVPAQTRLVESRREITREYEAVAIGH
1v9kA           TAVHGGSGLSFGVIEGLRALRPERFLELVHRLDRDTSGVLLVAKKRSALRSLHEQEKGXQKDYLALVRGQ
2apoA2          PTSHEVSTWVK-------KILNLDKAGHGGTLDPKVTGVLPVALER--ATKTIPMWHIPPKEYVCLMHLH
1k8wA5          MSSND-------ALQKVKRIYNANRAGHTGALDPLATGMLPICLGE--ATKFSQYLLDSDKRYRVIARLG
1ze2B2          PTSHD-------VVDEVRKKLKTRKVGHGGTLDPFACGVLIIGVNQ--GTRILEFYKDLKKVYGEYDQVP
1r3eA2          PTSHD-------VVDEVRKKLKTRKVGHGGTLDPFACGVLIIGVNQ--GTRILEFYKDLKKVYWVKMRLG
1vioA2          ----------------------------------------------------------------------
1dm9A           EAALLYEETAESVEKREKM---------------------------------------------------
1kskA3          ----------------------------------------------------------------------
1jh3A           ----------------------------------------------------------------------
1h3eA2          ----------------------------------------------------------------------
1p9kA           ----------------------------------------------------------------------
1fjgD           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           MTQEDVETFIKGIPLKDFTCQPARLEILSTDAEKNQSQIRVTIAEGKFHQIKRMVGYCGKEVVDLQRLTM
1kskA4          VADDTAEQFAKGVQLEKDLTKPAVLEVI------TPTQVRLTISEGRYHQVKRXFAAVGNHVVELHRERI
1przA           XTAGGTVDEPISRHPTKRTGKPAVTHYRIXEHFRVHTRLRLRLETGRTHQIRVHXAHITHPLVGDPVYGG
1v9kA           WQSHSVQAPLLKNILQSQEGKPSETRFKVEERYAFATLVRCSPVTGRTHQIRVHTQYAGHPIA-------
2apoA2          RDASEEDILRVFKEFTGRIYQRRIRKIHEELLDKDGKDVLFRVKCQSGTYIRKLCEDIGEAMQELRRTKS
1k8wA5          QRTDTSDADGQIVEERPVTFSAE------------QLAAALDTFRGDIEQIPSMYSALKYQGKKLYEYAR
1ze2B2          PAYSAKKYKGERLYGKIINLPPKRVKIFKIRVEVSPGTYIRVRESVGPHTIEESLNVFEA-APEEIENRI
1r3eA2          LITETYKLAREGKIINLPPKRVKIFKIW--DVNIEGRDVSFRVEVSPGTYIRSLCMDCGATAVELVRESV
1vioA2          ----------------------------------------------------------------------
1dm9A           ----------------------------------------------------------------------
1kskA3          ----------------------------------------------------------------------
1jh3A           ----------------------------------------------------------------------
1h3eA2          ----------------------------------------------------------------------
1p9kA           ----------------------------------------------------------------------
1fjgD           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GTLVLDENLERGEWRRLTKEELEILRANII
1kskA4          GGITLDADLAPGEYRPLTEEEIASV-----
1przA           RPRPPK-GASEAFISTLRKFDRQALHATXL
1v9kA           ------------------------------
2apoA2          GCFEEKQDLLDAYVFWKEDGDEEELRR---
1k8wA5          QGIEVPREARPITVYELL------------
1ze2B2          IPLEK-------------------------
1r3eA2          GPHTIE---ESLNVFEAAPEEIE-------
1vioA2          ------------------------------
1dm9A           ------------------------------
1kskA3          ------------------------------
1jh3A           ------------------------------
1h3eA2          ------------------------------
1p9kA           ------------------------------
1fjgD           ------------------------------