[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF56432.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1dpeA.bssp"
#ERROR : Can't open dsspfile "1uiuA.bssp"
#ERROR : Can't open dsspfile "1xocA1.bssp"
#ERROR : Can't open dsspfile "1b05A.bssp"
#ERROR : Can't open dsspfile "1uqwA.bssp"
#ERROR : Can't open dsspfile "1vr5A1.bssp"
#ERROR : Can't open dsspfile "1qhdA2.bssp"
#ERROR : Can't open dsspfile "1hhsA.bssp"
#ERROR : Can't open dsspfile "1qgiA.bssp"
#ERROR : Can't open dsspfile "1al0F.bssp"
#ERROR : Can't open dsspfile "1ex2A.bssp"

## Summary of PDB Search
:652
    7e-51  20%  1dpeA  [c.94.1.1] DIPEPTIDE-BINDING PROTEIN
    1e-49  17%  1uiuA  [c.94.1.1] NICKEL-BINDING PERIPLASMIC PROTEIN
    2e-48  17%  1xocA1 [c.94.1.1] OLIGOPEPTIDE-BINDING PROTEIN APPA A:17 -- 520
    3e-48  22%  1b05A  [c.94.1.1] PERIPLASMIC OLIGOPEPTIDE-BINDING PROTEIN
    2e-47  19%  1uqwA  [c.94.1.1] PUTATIVE BINDING PROTEIN YLIB
    1e-41  15%  1vr5A1 [c.94.1.1] OLIGOPEPTIDE ABC TRANSPORTER, PERIPLASMIC A:23 --
    2e-21  15%  1qhdA2 [b.19.1.1] VIRAL CAPSID VP6 A:149 -- 332
    6e-21  12%  1hhsA  [e.8.1.6] RNA-DIRECTED RNA POLYMERASE
    2e-05  15%  1qgiA  [d.2.1.7] PROTEIN (CHITOSANASE)
    3e-04   7%  1al0F  [b.121.5.1] CAPSID PROTEIN GPF
    0.001  16%  1ex2A  [c.51.4.2] PROTEIN MAF
:652

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxACGNSSTASKTYNYVYSSDPSSLNYLAENRAATSDIVANLVDGLLEN
1dpeA           --------------------------------KTLVYCSEGSPEGFNQLFISGTTYDASSVPLYNRLVEK
1uiuA           ---------------------------------EITTAWPVNVGPLNP-HLYTPNQMFAQSMVYEPLVKY
1xocA1          ------------------------------QGGDLVVGSIGEPTLFNSLYSTDDASTDIENMLYSFLTKT
1b05A           -----------------------PAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLIS
1uqwA           ------------------------------AAKDVVVAVGSNFTTLDPYDANDTLSQAVAKSFYQGLFGL
1vr5A1          --------------------------------LYWGGALWSPPSNWNP-FTPWNAVAGTIGLVYEPLFLD
1qhdA2          --------------------------NIFPYSASFTLNRSQPAHDNLMGTMWLNAGSEIQVAGFDYSCAI
1hhsA           ----------------------------------------------------------------------
1qgiA           ---------------------------------TFYNVYI--RYSVEQARQRGFTSAVTIGSFVDTALAT
1al0F           ----------------------------------------------------------------------
1ex2A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DQYGNIIPSLAEDWTVSQDGLTYTYKLRKDAKWFTSEGEEYAPVTAQDFVTGLQYAADKKSEALYLVQDS
1dpeA           IGTTEVIPGLAEKWEVSEDGKTYTFHLRKGVKWHNKEFKPTRELNADDVVFSFDRQKNAQNPYHK----V
1uiuA           QADGSVIPWLAKSWTHSEDGKTWTFTLRDDVKFSNGE-----PFDAEAAAENFRAVLDNRQRHAW-----
1xocA1          DEKLNVKLSLAESIKELDGGLAYDVKIKKGVKFHDGK-----ELTADDVVFTYSVPLSKDYKGER-----
1b05A           DVEGHPSPGVAEKWE-NKDFKVWTFHLRENAKWSDGT-----PVTAHDFVYSWQRLADPNTAASYLQYGH
1uqwA           DKEXKLKNVLAESYTVSDDGITYTVKLREGIKF--QDGT---DFNAAAVKANLDRASDPANHLKR-----
1vr5A1          PLNDKFEPWLAEKGEWVSNN-EYVLTLRKGLRW--QDGV---PLTADDVVFTFEIAKKYTGISYSPVWNW
1qhdA2          NAPANTQQFEHIVQ-LRRVLTTATITLLPDAERFS----FPRVITSADGATTWYFNPVILRPNNVEIEFL
1hhsA           -----------------------------------------PAFPLSDIKAQMLFANNI-----------
1qgiA           GGSDTLQGLLARSGSSSNEKTFMKNFHAKRTLVVDTN-KYNKPPNGKNRVKQWDTLVDMGKMNLK-----
1al0F           ----------------------------------------------------------------------
1ex2A           ------------------------------------RNFSPEENVQWLAKQKAKAVADLHPHAIVIGADT


                         +         .         .         .         .         *         .:210
query           VAGLDDYITGKTSDFSTVGVKALDDQTVQYTLVKPELYWNSKTLATILFPVNADFLKSKGDDFGKADPSS
1dpeA           SGGSYEYFEGMGLPELISEVKKVDDNTVQFVLTRPEAPFLADLAMDFASILSKEYADAMMKAGTPEKDLN
1uiuA           -LELANQIV---------DVKALSKTELQITLKSAYYPFLQELALPRPFRFIAPSQFKNHETM--NGIKA
1xocA1          -GSTYEMLK---------SVEKKGDYEVLFKLKYKDGNFYNNALDSTAILPKHILGNVPIADLEENERKK
1b05A           IANIDDIIAGKKPA-TDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPAN--
1uqwA           -HNLYKNIA---------KTEAIDPTTVKITLKQPFSAFINILAHPATAXISPAALEKYGKEIGFY----
1vr5A1          LGR----------------IERVDERTLKFVFSDPRYQEWKQXLINTPIVPKHIWENKTEEEVLQAANEN
1qhdA2          L--NGQIINTYQARFGTIIARNFDTIRLSFQLMRPPPAVAALFPNAQPFEHHATVGLTLRIESA------
1hhsA           --KAQQASKRSFK------EGAIETYEGLLSVDPRFLSFKN-ELSRYLTDHFPANVDEYGRVYGNGVRTN
1qgiA           ----------------------------------------------------------------------
1al0F           ----------------------------------------------------------------------
1ex2A           MVCLDGECLGKPQDQEEAMLRRLSGRSHS-----------------------------------------


                         .         .         .         +         .         .         .:280
query           ILYNGPFLMKALVSKSAIEYKKNPNYWDAKNVFVDDVKLTYYDGSDQESLERNFTAGAYTTARLFPNSSS
1dpeA           PIGTGPFQLQQYQKDSRIRYKAFDGYWGTKPQI---DTLVFSITPDASVRYAKLQKNECQVMP-YPNPAD
1uiuA           PIGTGPWILQESKLNQYDVFVRNENYWGEKPAI---KKITFNVIPDPTTRAVAFETGDIDLLYGNEGLLP
1xocA1          PIGSGPFKFKEWKQGQYIKLEANDDYFEGRPYL---DTVTYKVIPDANAAEAQLQAGDINFFNVPA--TD
1b05A           IVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVIN--QVTYLPISSEVTDVNRYRSGEIDMTYNNMPIEL
1uqwA           PVGTGPYELDTWNQTDFVKVKKFAGYWQPGLPKLD--SITWRPVADNNTRAAXLQTGEAQFAFPIPYEQA
1vr5A1          PVGSGPYYVES-WADDRCVFKKNGNWWGIRELGYDPKRIVELRVLSNNVAVGXLXKGELDWSNFFLPGVL
1qhdA2          ----------------------------------------------------------------------
1hhsA           FFNGFPMIPATWPLASNLKKRADADLADGPVSERDNLLFRAAVRLMFSDLEPVPLKIRKGSSTCIPYFSN
1qgiA           ----------------------------------------------------------------------
1al0F           ---LSHLGFLAGQIGRLITISTTPVIAGDSFEMDAVGALRLSPLRRGLAIDSTVDIFTFYVPHRHVYGEQ
1ex2A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           YEGIKEKYKNNIIYSMQNSTSYFFNFNLDRKSYNYTSKTSDIEKKSTQEAVLNKNFRQAINFAFDRTSYG
1dpeA           IARM-KQDKSINLMEMPGLNVGYLSYNVQKKPLD------------------DVKVRQALTYAVNKDAI-
1uiuA           LDTFASQNPAYHTQLSQPIETVMLALNTAKAPTN------------------ELAVREALNYAVNKKSLI
1xocA1          YKTAEKFNNLKIVTDLALSY-VYIGWNEKNELFK------------------DKKVRQALTTALDR----
1b05A           FQKLKKEIPNEVRVDPYLCT-YYYEINNQKAPFN------------------DVRVRTALKLALDR----
1uqwA           TLLEKN--KNIELXASPSIXQRYISXNVTQKPFD------------------NPKVREALNYAINR----
1vr5A1          KKAYGIVTWYENAPYXLPANTAGIYINVNKYPLS------------------IPEFRRAXAYAINPEKIV
1qhdA2          ----------------------------------------------------------------------
1hhsA           DMGTKIEIAERALEKAE-----EAGNLMLQGKFDDAYQLHQMGGAY------YVVYRAQSTDAITLDPKT
1qgiA           ----------------------------------------------------------------------
1al0F           W----IKFMKDGVNATPLPTVNTTG---------------------------------------------
1ex2A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AQSEGKEGATKILRNLVVPPNFVSIKGKDFGEVVASKMVNYGKEWQGINFADGQDPYYNPXXXXXXXXXX
1dpeA           --------IKAVYQGAGVSAKNLIPPTMWGYN------------------DDVQDYTYDP-------EKA
1uiuA           DNALY--GTQQVADTLFAPSVPYANLGLKPSQYDPQKAKALLEKA-GWTLPAGKDIREKN----------
1xocA1          -----ESIVSQVLDGDGEVYIPESPLSWNYPKDIDVPKFEYNEKKAKQMLAEAGWKDTNG----------
1b05A           -----DIIVNKVKNQGDLPAYSYTPPY----------TDGAKLVEP---EWFKWSQQKRNEEAKKLLAEA
1uqwA           -----PALVKVAFAGYATPATGVVPPSIAYAQ-------------------SYKPWPYDPVKARELLKEA
1vr5A1          TRAYE--NXVTAANPAGILPLPGYXKYYPK-EVVDKYGFKYDPEXAKKILDELGFKDVN---------KD
1qhdA2          ----------------------------------------------------------------------
1hhsA           GKFVSKDRMVA-------DFEYAVTGGEQGSLFAASKDASRLKEQYGIDVPDGFFCERRRTA--------
1qgiA           ----------------------------------------------------------------------
1al0F           ----------------------------------------------------------------------
1ex2A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           XXXXXXXGVQFPIHLDKTVEVTDKVGIQGVSSIKQSIESVLGSDNVVIDIQQLTSDEFDSSGYFAQTAAQ
1dpeA           KALLKEAGLEKGFSIDLWAMPVQRPYNPNARRMAEMIQADWAKVGVQAKIVTYEWGEYL------KRAKD
1uiuA           -------GQPLRIELSFIGTDALSKSMA------EIIRADMRQIGADVSLIGEEESSIY------ARQRD
1xocA1          DGILDKDGKKFSFTLKTNQGNKVREDIA------VVVQEQLKKIGIEVKTQIVEWSALV------EQMNP
1b05A           G---------FTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKT------FLDTRHQ
1uqwA           G---------YPNGFSTTLWSSH--NHSTAQKVLQFTQQQLAQVGIKAQVTAXDAGQR-AAEVEGKGQKE
1vr5A1          GFREDPNGKPFKLTIECPYGWTDWXVSI------QSIAEDLVKVGINVEPKYPDYSKYA------DDLYG
1qhdA2          ----------------------------------------------------------------------
1hhsA           ------------MGGPFALNAPIMAVAQPVRNKIYSKYAYTFHHTTRLNKEEKVKE-----WSLCVATDV
1qgiA           ----------------------------------------------------------------------
1al0F           ----------------------------------------------------------------------
1ex2A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           KDYDLYHGGWGPDYQDPSTYLDIFNTNSGGVLXNLGLEPGEXNDKAKAVGLDVYTQMLEEANKEQDPAKR
1dpeA           GEHQTVMMGWTGDNGDPDNFFATESCAASEQGSNYS---KWCYKP--------FEDLIQPARATDDHNKR
1uiuA           GRFGMIFHRTWGAPYDPHAFLSSMRVPSHA--------DFQAQQ--GLADKPLIDKEIGEVLATHDETQR
1xocA1          PNWDFDAMVMGWSLSTFPDQYDIFHSSQIKKGLNYV---WYKNAE--------ADKLMKDAKSISDRKQY
1b05A           GTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHY--------------KSPAFDKLIADTLKVADDTQR
1uqwA           SGVRXFYTGWSASTGEADWALSPLFASQNW-------PPTLFNTAFYS--NKQVDDFLAQALKTNDPAEK
1vr5A1          GKFDLILNNFTTGVSATIWSYFNGVFYPDAVESEYSYSGNFGKYANPE-----VETLLDELNRSNDDAKI
1qhdA2          ----------------------------------------------------------------------
1hhsA           SDHDTFWPGWLRDLICD----ELLNMGY------------------------------------------
1qgiA           ----------------------------------------------------------------------
1al0F           ----------------------------------------------------------------------
1ex2A           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           YEKYADIQAWLIDSSLVLPSVSRGGTPSLRRTVPFAAAYGLTGTKGVESYKYLKVQDKIVTTDEYxxxxx
1dpeA           VELYKQAQVVMHDQAPALI---------------------------------------------------
1uiuA           QALYRDILTRLHDEAVYLP---------------------------------------------------
1xocA1          SKEYEQIYQKIAEDQPYTF---------------------------------------------------
1b05A           SELYAKAEQQLDKDSAIVPVYYYVNARLVKPWV-------------------------------------
1uqwA           TRLYKAAQDIIWQESPWIP---------------------------------------------------
1vr5A1          KEVVAKLSEILLKDLPFIPLWYNGAWFQASEAVNWPTEKNPYAVPIGWNGWWQLTGIKTLFGIEA-----
1qhdA2          ----------------------------------------------------------------------
1hhsA           ----------------------------------------------------------------------
1qgiA           ----------------------------------------------------------------------
1al0F           ----------------------------------------------------------------------
1ex2A           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxx
1dpeA           ----------------------
1uiuA           ----------------------
1xocA1          ----------------------
1b05A           ----------------------
1uqwA           ----------------------
1vr5A1          ----------------------
1qhdA2          ----------------------
1hhsA           ----------------------
1qgiA           ----------------------
1al0F           ----------------------
1ex2A           ----------------------