[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF56471.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1uqwA.bssp"
#ERROR : Can't open dsspfile "1xocA1.bssp"
#ERROR : Can't open dsspfile "1vr5A1.bssp"
#ERROR : Can't open dsspfile "1dpeA.bssp"
#ERROR : Can't open dsspfile "1b05A.bssp"
#ERROR : Can't open dsspfile "1uiuA.bssp"

## Summary of PDB Search
:234
    3e-06  16%  1uqwA  [c.94.1.1] PUTATIVE BINDING PROTEIN YLIB
    3e-05  12%  1xocA1 [c.94.1.1] OLIGOPEPTIDE-BINDING PROTEIN APPA A:17 -- 520
    3e-05  10%  1vr5A1 [c.94.1.1] OLIGOPEPTIDE ABC TRANSPORTER, PERIPLASMIC A:23 --
    6e-05  20%  1dpeA  [c.94.1.1] DIPEPTIDE-BINDING PROTEIN
    8e-05  17%  1b05A  [c.94.1.1] PERIPLASMIC OLIGOPEPTIDE-BINDING PROTEIN
    1e-04  19%  1uiuA  [c.94.1.1] NICKEL-BINDING PERIPLASMIC PROTEIN
:234

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxACGKTDKEADAPTTFSYVYAVDPASLGYSIATRTSTTDVIGNVIDGLMENDKYGNVAPSQ
1uqwA           -----------------------------------------------------------AAEVEGKGQKE
1xocA1          -----------------KPQQGGDLVVGSIGEPTLFNSLYSTDDASTDIENMLYSFLTKTDEKLNVKL-P
1vr5A1          ---------------------------------------------------------------------G
1dpeA           ---------------------------------------------------------------------D
1b05A           ----------ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSP--
1uiuA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KDYDLNSTGWAPSYQDPASYLNIMDPKSGSAMKHLGITKGKDKDVVAKPGLDKYKKLLEDAVSETTDLEK
1uqwA           SGVRXFYTGWSASTGEADWALSPLFASQNWPPTLFNTAFYSNK---------QVDDFLAQALK-TNDPAE
1xocA1          PNWDFDAMVMGWSLSTFPDQYDIFHSSQIKKGLNYVW--------YKNAEADK----LMKDAKSISDRKQ
1vr5A1          GKFDLILNNFTTGVSATIWSYFNGVFYPDAVESE-----YSYSGNFGKYANPEVETLLDELNRSN-DDAK
1dpeA           GEHQTVMMGWTGDNGDPDNFFATEFSCAA----------SEQGSNYSKWCYKPFEDLIQPARA-TDDHNK
1b05A           ----------------------------------------------------------------------
1uiuA           GRFGMIFHRTWGAPYDPHAFLSSM---RVPSHADFQAQQGLADK----PLIDK----EIGEVLATHDETQ


                         +         .         .         .         .         *         .:210
query           RYEKYAKAQAWSTDSSLLMPTAXXXXXXXXXXXXXFSKPYSQVGIKGEPYIFKGMKLQKDIVTTKEYxxx
1uqwA           KTRLYKAAQDIIWQESPWIP--------------------------------------------------
1xocA1          YSKEYEQIYQKIAEDQPYTF--------------------------------------------------
1vr5A1          IKEVVAKLSEILLKDLPFIPLWYNGAWFQASEAVWTNWPTENPYAVPIGWNGWWQLTGIKTLFGIEA---
1dpeA           RVELYKQAQVVMHDQAPALI--------------------------------------------------
1b05A           ----------------------------------------------------------------------
1uiuA           RQALYRDILTRLHDEAVYLP--------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxx
1uqwA           ------------------------
1xocA1          ------------------------
1vr5A1          ------------------------
1dpeA           ------------------------
1b05A           ------------------------
1uiuA           ------------------------