[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF56657.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1t6sA1.bssp"
#ERROR : Can't open dsspfile "1t6sA2.bssp"

## Summary of PDB Search
:189
    2e-10  26%  1t6sA1 [a.4.5.60] CONSERVED HYPOTHETICAL PROTEIN A:1 -- 85
    5e-08  41%  1t6sA2 [a.4.5.60] CONSERVED HYPOTHETICAL PROTEIN A:86 -- 162
:189

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxLAKIEALLFVAGEDGIRVRQLAELLSLPPTGIQQSLGKLAQKYEKDPDSSLALIETSGAYRLVTKPQ
1t6sA1          ---LRSLEALIFSSEE-PVNLQTLSQITAHKPSELQEAVDELNRDYEA-TGRTFRIHAIAGGYRFLTEPE
1t6sA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FAEILKEYxxxxxxxxLSRAALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIKEDGKKEVLG
1t6sA1          FADLVRQL--------------------------------------------------------------
1t6sA2          ----------------LSRSMLEVLAVVAWHQPVTKGEIQQIRGASPDYSIDRLLARGLIEVRGRADSPG


                         +         .         .         .         .         *         .:210
query           RPNLYVTTDYFLDYMGIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1t6sA1          -------------------------------------------------
1t6sA2          RPLQYGTTEVFLDLFHL--------------------------------