[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF56666.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2df4B2.bssp"
#ERROR : Can't open dsspfile "1zq1C3.bssp"
#ERROR : Can't open dsspfile "1obbA2.bssp"
#ERROR : Can't open dsspfile "2df4B1.bssp"
#ERROR : Can't open dsspfile "1bglA2.bssp"
#ERROR : Can't open dsspfile "1zq1C1.bssp"
#ERROR : Can't open dsspfile "2d6fC1.bssp"
#ERROR : Can't open dsspfile "1jjuB.bssp"

## Summary of PDB Search
:480
    e-138  70%  2df4B2 [d.128.1.5] ASPARTYL/GLUTAMYL-TRNA(ASN/GLN) AMIDOTRANSFERASE
    4e-94  28%  1zq1C3 [d.128.1.5] GLUTAMYL-TRNA(GLN) AMIDOTRANSFERASE SUBUNIT E
    1e-39  10%  1obbA2 [d.162.1.2] ALPHA-GLUCOSIDASE A:173 -- 480
    5e-30  55%  2df4B1 [a.182.1.2] ASPARTYL/GLUTAMYL-TRNA(ASN/GLN) AMIDOTRANSFERASE
    2e-23  11%  1bglA2 [b.1.4.1] BETA-GALACTOSIDASE A:626 -- 730
    3e-14  22%  1zq1C1 [a.182.1.2] GLUTAMYL-TRNA(GLN) AMIDOTRANSFERASE SUBUNIT E
    5e-11  36%  2d6fC1 [a.182.1.2] GLUTAMYL-TRNA(GLN) AMIDOTRANSFERASE SUBUNIT E
    6e-04  19%  1jjuB  [b.69.2.2] QUINOHEMOPROTEIN AMINE DEHYDROGENASE
:480

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xNFETVIGLEVHVELNTNSKIFSPTSAHFGNDQNANTNVIDWSFPGVLPVLNKGVVDAGIKAALALNMDI
2df4B2          -HFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEI
1zq1C3          -NYEELVGLEIHRQLDTK-KLFSPVPSELSDKVEGNYELTDLVYMDEEPPPDREALEVALQIAYLLNAKP
1obbA2          ----------------------------------------------------------------------
2df4B1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
1zq1C1          ----------------------------------------------------------------------
2d6fC1          ----------------------------------------------------------------------
1jjuB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           HKKMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEVELEDGTTKKIGIERAHLEEDAGKNTHGTDGYSY
2df4B2          ATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEV-DGETKRIGITRLHMEEDAGKSTHKGE-YSL
1zq1C3          VDEVYYMRKIVIDGSNVSGFQRTAI---IATDGKVETPW-----GAVGIPTICLEEDAARIIERKDKEVI
1obbA2          ---------------------------------------------------HYGVMEIVEK-LGLEE-EK
2df4B1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
1zq1C1          ----------------------------------------------------------------------
2d6fC1          ----------------------------------------------------------------------
1jjuB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VDLNRQGVPLIEIVSEADMRSPEEAYAYLTALKEVIQYAGISDVKMEEGSMRVDANISLRPYGQEKFGTK
2df4B2          VDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTK
1zq1C3          YRLDRLGIPLIEISTTPDIHHPEQAKVVAKFIGDALRA--TKKVKRGLGTIRQDLNVSIKG------GAR
1obbA2          VDWQVAGVNHGIWLNRFRYNGGNAY-------PLLDKWIEEKSKDWKPENPFNDQLSPAAIDMYRFYGVM
2df4B1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------RLSGQT
1zq1C1          ----------------------------------------------------------------------
2d6fC1          ----------------------------------------------------------------------
1jjuB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           TELKNLNSFSNVRKGLEYEVQRQAEILRSGGQIRQETRRYDEANKATILMRVKEGAADYRYFPEPDXPLF
2df4B2          AELKNLNSFNYVRKGLEYEEKRQEEELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPL
1zq1C3          IEIKGVQELDMIPIIIEREVERQLNLLKIRDELRKEETRRALPDGNTEYMRPLPG--KARMYPETDIPPL
1obbA2          PIGDTVRNS-SWRYHRDLETKKKWYGEPWGGADSEIGWKWYQDTLGKVTEITKKVAKFIKENPSVRLSDL
2df4B1          ----------------------------------------------------------------------
1bglA2          IEVTSEYLFRHSD---NELLHWM--VALDGKPLASGEVPLDVAPQGKQLIELPELPQPESLWLTVRVVQ-
1zq1C1          ----------------------------------------------------------------------
2d6fC1          ----------------------------------------------------------------------
1jjuB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           EIXDEWIEEMRTELPEFPKERRARYVSDLGLSDYDASQLTANKVTSDFFEKAVALDGDAKQVSNWLQGEV
2df4B2          YIDDAWKERVRQTIP-------------------------------------------------------
1zq1C3          RIPDDLKKKIKENLP-------------------------------------------------------
1obbA2          GSVLGKDLSEKQFVLEVEKILDPERKSGEQHIPFIDALLN---DNKARFVVNIPNKGIIHGIDDDVVVEV
2df4B1          ---------------ELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGV
1bglA2          PNATAWSEISAWQQWRLAENLSVT----------------------------------------------
1zq1C1          ---------------ELPQAKVERYVKEYKLDRSLAQTLV-DDERDELFEELVSMGVKPSLAASILVVVL
2d6fC1          ---------------ELPSEKKERIMRDYGLSEDLASQLVKRNLVDEFDTTVIA----------------
1jjuB           ----------------------------------DTEKMAVDKVITIAMVPMVAPGGRIAYATVNKSESL


                         .         .         .         .         *         .         .:420
query           AQFLNAEGKTLEQIELTPENLVEMIAIIEDGTISSKIAKKVFVHLAKNGGGAREYVEKAGMVQISDPAIL
2df4B2          ----------------------------------------------------------------------
1zq1C3          ----------------------------------------------------------------------
1obbA2          PALVDKNGPEKIEPPLPDRVVKYYL-------RPRIMRMEMALEAFLT-GDIRIIKELLYRDPTKSDEQV
2df4B1          NEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNA------------------
1bglA2          ----------------------------------------------------------------------
1zq1C1          ----------------------------------------------------------------------
2d6fC1          ----------------------------------------------------------------------
1jjuB           VKIDLVTGETLGRIDLSEERVKSLAALSPDG-------KTLAIYESPVRLELTHFEVQPTRVALYD----


                         .         .         +         .         .         .         .:490
query           IPIIHQVFADNEAAVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2df4B2          ------------------------------------------------------------
1zq1C3          ------------------------------------------------------------
1obbA2          EKVIEEILALPENEE---------------------------------------------
2df4B1          ------------------------------------------------------------
1bglA2          ------------------------------------------------------------
1zq1C1          ------------------------------------------------------------
2d6fC1          ------------------------------------------------------------
1jjuB           ------------------------------------------------------------